Syntrophotalea carbinolica: Pcar_1259
Help
Entry
Pcar_1259 CDS
T00285
Symbol
msbA
Name
(GenBank) phospholipid/lipopolysaccharide-flipping ABC transporter MsbA
KO
K11085
ATP-binding cassette, subfamily B, bacterial MsbA [EC:
7.5.2.6
]
Organism
pca
Syntrophotalea carbinolica
Pathway
pca02010
ABC transporters
Brite
KEGG Orthology (KO) [BR:
pca00001
]
09130 Environmental Information Processing
09131 Membrane transport
02010 ABC transporters
Pcar_1259 (msbA)
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
pca02000
]
Pcar_1259 (msbA)
Enzymes [BR:
pca01000
]
7. Translocases
7.5 Catalysing the translocation of carbohydrates and their derivatives
7.5.2 Linked to the hydrolysis of a nucleoside triphosphate
7.5.2.6 ABC-type lipid A-core oligosaccharide transporter
Pcar_1259 (msbA)
Transporters [BR:
pca02000
]
ABC transporters, eukaryotic type
ABCB (MDR/TAP) subfamily
ABCB-BAC subgroup
Pcar_1259 (msbA)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
ABC_membrane
ABC_tran
SMC_N
AAA_21
AAA_5
AAA_22
Zeta_toxin
AAA_16
RsgA_GTPase
ABC_ATPase
AAA_29
nSTAND1
Motif
Other DBs
NCBI-ProteinID:
ABA88508
UniProt:
Q3A549
LinkDB
All DBs
Position
1479116..1480855
Genome browser
AA seq
579 aa
AA seq
DB search
MKYNPKQLYQRLWRYSKPYLPRVFLAMFASIVVSGVDVATAKLVKPFVDDVLMAADRGLA
NLVPIIVIGLAVCKGGGRYIQEYFIKTAGQMVVQDIRNDLYRHSMNLSMGYFSRSSTGNV
MSRILNDVGALQRSAADVMVDGLRESFTLMGLTFVAFQSDWRLATIAFLVMPVSIVPASV
IGRRIKENTRRGQRTMGTLTRVLQESLAGIKVIKAFGSEDRECQRFRTENKRFYHFIRKV
LKYDSAATPVIEILSSFGIGAVLWYGIRRVSDGAMTQGDLSAFIAALFMMYAPMKRLTKV
SNTIQRSLGAAERVFELMDEVPEIADQPDAIQAPRAVGNIVFEHVGFSYGDEPVLHDLNL
SIRAGEIAALVGPSGGGKSTVIGLLNRFYDPQQGAIHIDGYDIRQLTQDSLKQSMALVDQ
ETFLFNDTVWNNIRYGRPEASDSEVEEAARQAYADEFVRAMPDGYETVIGDRGVRLSGGQ
RQRICIARAILRDAPILLLDEATSALDTESEATVQKALVNLMNNRTTIVVAHRLSTVMHA
DKIVVLEGGRIREIGRHQDLLSGDGLYRRLYEMQFADRD
NT seq
1740 nt
NT seq
+upstream
nt +downstream
nt
ttgaaatacaatcctaaacaactttatcagcgcctttggcgctattccaagccttatctg
ccccgggtgtttctggcgatgttcgcatctatcgtggtttccggcgtggatgtggcaacc
gccaagttggtgaagccctttgtcgatgatgtgctgatggcggccgacagaggtctggcc
aatctggtaccgatcatcgtgattggtctggctgtttgcaagggaggcgggcgttatatc
caggaatattttatcaagactgccggtcagatggtggtgcaggatatccgtaatgatctc
tatcgacattccatgaatctctccatgggatacttttcgcgcagttccacgggcaacgtg
atgtctcgcatccttaacgatgtcggtgccctgcagagatcagccgcggatgtcatggtc
gatggcctgcgggagagttttacccttatggggctgactttcgtggcttttcagagcgat
tggcgtttggccaccattgcatttctggtgatgcctgtatccattgttcccgcaagtgtc
atcggcagacgtatcaaagaaaacacccggcggggccaacgcaccatgggtaccttgacc
cgggttctgcaggagagtcttgccggcatcaaagtcatcaaggcctttggctccgaagat
cgggaatgtcagcggttcagaaccgagaacaaacgtttctatcattttatccgtaaggtt
ctgaagtacgattcggcggccaccccagtgatcgagatcctctcgtccttcggcatcggc
gccgttctttggtacggtatccgccgggtcagcgacggagccatgacgcagggggatttg
tcggcgtttatcgccgcattgttcatgatgtatgcccccatgaagcgtttgaccaaggta
agcaataccatccagcggtcactcggtgccgcggagcgggtctttgaactcatggatgaa
gttcccgaaattgccgatcagcccgatgccatacaggcgccaagagctgtcgggaatatc
gtttttgagcatgtgggtttctcgtatggtgatgagccggtgctgcatgatcttaatctg
tcgattcgggccggggaaattgcggccctggtcggtccgagcggcggcggtaaatcgacc
gttatcggccttctgaaccgtttttacgacccgcaacagggtgccattcatatcgatggg
tacgatatccgtcaattgacccaggatagcctcaaacagagcatggccctggtcgatcag
gaaacctttttgtttaacgatacggtgtggaataatatccgttacggtcgtcccgaagcc
agcgattccgaagtcgaagaggctgccaggcaggcttatgcggacgagttcgtgcgtgcc
atgcccgatgggtatgaaacggttatcggcgaccggggcgtccgcctgtccggcggccag
cgccagcgcatctgcattgcacgcgccattttgcgcgatgcgccgattctactgcttgac
gaggcgaccagtgccctcgacaccgaaagcgaagcaacggtgcaaaaagctctcgtcaat
cttatgaacaaccgtaccaccatcgttgtcgcgcatcggctatccaccgtcatgcatgcc
gacaagatcgtggttctggagggtggccgtattcgcgaaatcggtcgccatcaggatttg
ctctccggtgacggtctttaccggcgtctgtatgagatgcaattcgccgaccgggattga
DBGET
integrated database retrieval system