Syntrophotalea carbinolica: Pcar_2663 Help Entry Pcar_2663         CDS       T00285                                  Symbol acpP-8 Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pca  Syntrophotalea carbinolica Pathway pca00998   Biosynthesis of various antibiotics pca01100   Metabolic pathways pca01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pca00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Pcar_2663 (acpP-8)    00074 Mycolic acid biosynthesis     Pcar_2663 (acpP-8)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Pcar_2663 (acpP-8) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  ABA89899 UniProt:  Q3A158 LinkDB All DBs Position complement(3115540..3115800) Genome browser AA seq 86 aa AA seqDB search MTDQEIIAAANAALAEEFELELSEMVPEARFDDDLDLDSLDAVDMVIVLEQTFGIKLRDS EAIREIRTLDDLYRFLIAKKAELAGA NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgaccgatcaggaaattatagcagccgccaatgccgcgctggccgaagagttcgagctg gaactgtccgagatggtacctgaagcccgtttcgatgacgacctcgatctcgacagcctg gacgcggtcgatatggttattgtgctggagcagaccttcggtatcaaattgcgcgacagc gaggcgatccgggagattcgcacgcttgatgatctgtaccggtttttgattgccaaaaaa gccgaactggccggggcctga

DBGET integrated database retrieval system