Pseudomonas canadensis: V6L78_01180 Help Entry V6L78_01180       CDS       T10710                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pcaa  Pseudomonas canadensis Pathway pcaa01100   Metabolic pathways pcaa01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pcaa00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     V6L78_01180    00074 Mycolic acid biosynthesis     V6L78_01180   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     V6L78_01180 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF1493 Motif Other DBs NCBI-ProteinID:  WWL84544 LinkDB All DBs Position 280952..281206 Genome browser AA seq 84 aa AA seqDB search MQTRDDIFNTLRDALVELFELPPERVTLDANLYQDLEIDSIDAVDLIDHIKRQTGKKIAA EEFKAVRTVNDVVEAVYRLVTPAA NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgcaaactcgtgacgatattttcaacaccttgcgcgatgccctggtggaactgtttgaa ctgccgccggaacgcgtcacccttgacgccaacctgtaccaggacctggaaatcgacagc atcgatgccgtcgacttgatcgaccacatcaagcgccagaccggcaagaaaatcgccgcc gaagagttcaaggccgtgcgcaccgtgaacgacgtggttgaggcggtgtaccgtctggtc acgcctgccgcatga

DBGET integrated database retrieval system