Pseudomonas canadensis: V6L78_07355 Help Entry V6L78_07355       CDS       T10710                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pcaa  Pseudomonas canadensis Pathway pcaa01100   Metabolic pathways pcaa01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pcaa00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     V6L78_07355    00074 Mycolic acid biosynthesis     V6L78_07355   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     V6L78_07355 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Other DBs NCBI-ProteinID:  WWL85708 LinkDB All DBs Position 1585174..1585437 Genome browser AA seq 87 aa AA seqDB search MDGNLTRAEISEKVIQLFVDIIGFIDRSQVTEQTDFIRDFKIIDDDLTCFVMQIKWQFNL QATQADWDRITTIKQIVDLIVERSNLL NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atggacggtaatctgaccagggccgagatcagcgaaaaggtgattcaactgttcgtcgac atcattggcttcatcgaccgaagccaggtgacggagcaaacggatttcatccgcgacttc aagatcattgatgacgacctgacctgcttcgtcatgcagatcaagtggcaattcaatctg caagccactcaggcagattgggatcgcatcaccacgatcaagcagattgtcgatttgatt gttgagcgctcaaatctgctttga

DBGET integrated database retrieval system