Pseudomonas cannabina pv. alisalensis: JGS08_09000 Help Entry JGS08_09000       CDS       T07379                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pcab  Pseudomonas cannabina pv. alisalensis Pathway pcab00998   Biosynthesis of various antibiotics pcab01100   Metabolic pathways pcab01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pcab00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     JGS08_09000 (acpP)    00074 Mycolic acid biosynthesis     JGS08_09000 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     JGS08_09000 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  QQN23733 LinkDB All DBs Position 1954953..1955189 Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIVAEQLGVKQEEVVNTASFVEDLGADSLDTVELVMALEEEFETEIPDEEA EKITTVQAAIDYVTAHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcaccatcgaagagcgcgtcaagaaaatcgttgccgagcaacttggcgtcaaacaa gaagaggttgtcaacactgcttctttcgttgaagacctgggcgctgactccttggacacc gttgagctggtaatggctctggaagaggaattcgagaccgaaatccctgacgaagaagcg gaaaagatcacgaccgttcaagcagcaatcgattacgtcactgcccatcaggcataa

DBGET integrated database retrieval system