Pectobacterium cacticida: OI450_17770 Help Entry OI450_17770       CDS       T08693                                  Symbol zapB Name (GenBank) cell division protein ZapB   KO K09892   cell division protein ZapB Organism pcac  Pectobacterium cacticida Brite KEGG Orthology (KO) [BR:pcac00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pcac03036]     OI450_17770 (zapB) Chromosome and associated proteins [BR:pcac03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     OI450_17770 (zapB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ZapB CtIP_N Leu_zip T3SchapCesA CC149 ERM_helical CC2-LZ Seryl_tRNA_N XRCC4_CC YabA Occludin_ELL DUF3450 Herpes_UL6 UPF0242 APG6_N FlaC_arch DUF2968 Motif Other DBs NCBI-ProteinID:  UYX06709 LinkDB All DBs Position 3903625..3903867 Genome browser AA seq 80 aa AA seqDB search MSFEVFEKLEAKVQQAIDTITLLQMEIEELKEQNNTLSQDAQAAAAAREALVRENEQLKE EQVVWQERLRALLGKMEEVQ NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgtcatttgaagtgtttgaaaagctggaagcaaaagttcagcaggcgattgatactatc acgctgttgcaaatggaaattgaagagctgaaagagcagaacaacacgctgtcgcaggat gctcaggcggcagcggccgcacgtgaagcgctggtgcgcgagaacgaacagctaaaagaa gaacaagtcgtatggcaagagcgcctgcgcgcgctgctaggtaaaatggaagaagttcaa taa

DBGET integrated database retrieval system