Physeter macrocephalus (sperm whale): 102973461 Help Entry 102973461         CDS       T06011                                  Name (RefSeq) glutathione S-transferase P   KO K23790   glutathione S-transferase P [EC:2.5.1.18] Organism pcad  Physeter macrocephalus (sperm whale) Pathway pcad00480   Glutathione metabolism pcad00980   Metabolism of xenobiotics by cytochrome P450 pcad00982   Drug metabolism - cytochrome P450 pcad00983   Drug metabolism - other enzymes pcad01100   Metabolic pathways pcad01524   Platinum drug resistance pcad05200   Pathways in cancer pcad05204   Chemical carcinogenesis - DNA adducts pcad05215   Prostate cancer pcad05225   Hepatocellular carcinoma pcad05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pcad00001]  09100 Metabolism   09106 Metabolism of other amino acids    00480 Glutathione metabolism     102973461   09111 Xenobiotics biodegradation and metabolism    00980 Metabolism of xenobiotics by cytochrome P450     102973461    00982 Drug metabolism - cytochrome P450     102973461    00983 Drug metabolism - other enzymes     102973461  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102973461    05204 Chemical carcinogenesis - DNA adducts     102973461   09162 Cancer: specific types    05225 Hepatocellular carcinoma     102973461    05215 Prostate cancer     102973461   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     102973461   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     102973461  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:pcad02000]     102973461 Enzymes [BR:pcad01000]  2. Transferases   2.5  Transferring alkyl or aryl groups, other than methyl groups    2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)     2.5.1.18  glutathione transferase      102973461 Transporters [BR:pcad02000]  Other transporters   Pores ion channels [TC:1]    102973461 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  GST_C_3 GST_C GST_N GST_C_7 GST_C_2 GST_N_3 Motif Other DBs NCBI-GeneID:  102973461 NCBI-ProteinID:  XP_007126992 Ensembl:  ENSPCTG00005019507 UniProt:  A0A2Y9FMR5 LinkDB All DBs Position Unknown AA seq 208 aa AA seqDB search MPPYTIVYFPVRGRCEAMRMLLADQDQSWKEEVVTMESWPSLKGSCLYGQLPKFQDGDLT LYQSNAILRHLGRSLGLYGKDQREAALVDVVNDGVEDLRCKYVTLIYTNYEAGKEDYVKA LPQHLKPFETLLSQNQGGQAFIVGNQISFADYNLLDLLRIHQVLASSCLDSFPLLSAYVA RLSARPKLQAFLASPEHVNRPINGNRKQ NT seq 627 nt NT seq  +upstreamnt  +downstreamnt atgccgccctacaccatcgtctacttccctgttcgagggcgctgcgaggccatgcgcatg ctgctggccgaccaggaccagagctggaaggaagaggtggtgactatggagagctggcct tcactcaagggctcctgtctgtacgggcagctccccaagttccaggatggagacctgacc ctgtaccagtccaatgctatcttgcgtcacctgggccgctcccttgggctgtatgggaag gaccagcgggaggcggccctggtggacgtggtgaatgacggcgtggaggaccttcgctgc aaatacgtcaccctcatctacacaaactacgaggcgggcaaggaggactatgtgaaggca ctgccccagcacctgaagccttttgagaccctgctgtcccagaaccagggcggccaggcc ttcattgtgggcaaccagatctcctttgccgactacaacctgctggacttgcttcggatt caccaggtcctggcctccagctgcctggactccttccccctgctctcggcctacgtggcc cgcctcagcgcccggcccaagctccaggccttcctggcctccccggagcacgtgaaccgc cccatcaatggcaacagaaaacagtga

DBGET integrated database retrieval system