Physeter macrocephalus (sperm whale): 102973672 Help Entry 102973672         CDS       T06011                                  Symbol NFKBIA Name (RefSeq) NF-kappa-B inhibitor alpha   KO K04734   NF-kappa-B inhibitor alpha Organism pcad  Physeter macrocephalus (sperm whale) Pathway pcad04024   cAMP signaling pathway pcad04062   Chemokine signaling pathway pcad04064   NF-kappa B signaling pathway pcad04210   Apoptosis pcad04380   Osteoclast differentiation pcad04620   Toll-like receptor signaling pathway pcad04621   NOD-like receptor signaling pathway pcad04622   RIG-I-like receptor signaling pathway pcad04623   Cytosolic DNA-sensing pathway pcad04625   C-type lectin receptor signaling pathway pcad04657   IL-17 signaling pathway pcad04658   Th1 and Th2 cell differentiation pcad04659   Th17 cell differentiation pcad04660   T cell receptor signaling pathway pcad04662   B cell receptor signaling pathway pcad04668   TNF signaling pathway pcad04722   Neurotrophin signaling pathway pcad04920   Adipocytokine signaling pathway pcad04926   Relaxin signaling pathway pcad04931   Insulin resistance pcad04936   Alcoholic liver disease pcad05132   Salmonella infection pcad05134   Legionellosis pcad05135   Yersinia infection pcad05140   Leishmaniasis pcad05142   Chagas disease pcad05145   Toxoplasmosis pcad05160   Hepatitis C pcad05161   Hepatitis B pcad05162   Measles pcad05163   Human cytomegalovirus infection pcad05164   Influenza A pcad05166   Human T-cell leukemia virus 1 infection pcad05167   Kaposi sarcoma-associated herpesvirus infection pcad05168   Herpes simplex virus 1 infection pcad05169   Epstein-Barr virus infection pcad05170   Human immunodeficiency virus 1 infection pcad05171   Coronavirus disease - COVID-19 pcad05200   Pathways in cancer pcad05203   Viral carcinogenesis pcad05208   Chemical carcinogenesis - reactive oxygen species pcad05215   Prostate cancer pcad05220   Chronic myeloid leukemia pcad05222   Small cell lung cancer pcad05235   PD-L1 expression and PD-1 checkpoint pathway in cancer pcad05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:pcad00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     102973672 (NFKBIA)    04668 TNF signaling pathway     102973672 (NFKBIA)    04024 cAMP signaling pathway     102973672 (NFKBIA)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     102973672 (NFKBIA)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     102973672 (NFKBIA)    04621 NOD-like receptor signaling pathway     102973672 (NFKBIA)    04622 RIG-I-like receptor signaling pathway     102973672 (NFKBIA)    04623 Cytosolic DNA-sensing pathway     102973672 (NFKBIA)    04625 C-type lectin receptor signaling pathway     102973672 (NFKBIA)    04660 T cell receptor signaling pathway     102973672 (NFKBIA)    04658 Th1 and Th2 cell differentiation     102973672 (NFKBIA)    04659 Th17 cell differentiation     102973672 (NFKBIA)    04657 IL-17 signaling pathway     102973672 (NFKBIA)    04662 B cell receptor signaling pathway     102973672 (NFKBIA)    04062 Chemokine signaling pathway     102973672 (NFKBIA)   09152 Endocrine system    04920 Adipocytokine signaling pathway     102973672 (NFKBIA)    04926 Relaxin signaling pathway     102973672 (NFKBIA)   09156 Nervous system    04722 Neurotrophin signaling pathway     102973672 (NFKBIA)   09158 Development and regeneration    04380 Osteoclast differentiation     102973672 (NFKBIA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102973672 (NFKBIA)    05208 Chemical carcinogenesis - reactive oxygen species     102973672 (NFKBIA)    05203 Viral carcinogenesis     102973672 (NFKBIA)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     102973672 (NFKBIA)   09162 Cancer: specific types    05220 Chronic myeloid leukemia     102973672 (NFKBIA)    05215 Prostate cancer     102973672 (NFKBIA)    05222 Small cell lung cancer     102973672 (NFKBIA)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     102973672 (NFKBIA)    05170 Human immunodeficiency virus 1 infection     102973672 (NFKBIA)    05161 Hepatitis B     102973672 (NFKBIA)    05160 Hepatitis C     102973672 (NFKBIA)    05171 Coronavirus disease - COVID-19     102973672 (NFKBIA)    05164 Influenza A     102973672 (NFKBIA)    05162 Measles     102973672 (NFKBIA)    05168 Herpes simplex virus 1 infection     102973672 (NFKBIA)    05163 Human cytomegalovirus infection     102973672 (NFKBIA)    05167 Kaposi sarcoma-associated herpesvirus infection     102973672 (NFKBIA)    05169 Epstein-Barr virus infection     102973672 (NFKBIA)   09171 Infectious disease: bacterial    05132 Salmonella infection     102973672 (NFKBIA)    05135 Yersinia infection     102973672 (NFKBIA)    05134 Legionellosis     102973672 (NFKBIA)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     102973672 (NFKBIA)    05140 Leishmaniasis     102973672 (NFKBIA)    05142 Chagas disease     102973672 (NFKBIA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102973672 (NFKBIA)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     102973672 (NFKBIA)    04931 Insulin resistance     102973672 (NFKBIA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:pcad03000]     102973672 (NFKBIA)    04131 Membrane trafficking [BR:pcad04131]     102973672 (NFKBIA) Transcription factors [BR:pcad03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    RHR (Rel homology region) Ankyrin only     102973672 (NFKBIA) Membrane trafficking [BR:pcad04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     102973672 (NFKBIA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ank_2 Ank Ank_3 Ank_5 Ank_4 ANK_LRRK2 Motif Other DBs NCBI-GeneID:  102973672 NCBI-ProteinID:  XP_007119015 Ensembl:  ENSPCTG00005009454 UniProt:  A0A2Y9FB78 LinkDB All DBs Position 11:complement(118558978..118562603) Genome browser AA seq 314 aa AA seqDB search MFQPAEPGQEWAMEGPRDALKKERLLDDRHDSGLDSMKDEEYEQMVKELREIRLEPQEAP RGAEPWKQQLTEDGDSFLHLAIIHEEKVLTMEVVRQVKGDLAFLNFQNNLQQTPLHLAVI TNQPEIAEALLEAGCDPELRDFRGNTPLHLACEQGCLASVGILTQPRGTQHLHSILQATN YNGHTCLHLASIHGYLGIVELLVSLGADVNAQEPCNGRTALHLAVDLQNPDLVSLLLKCG ADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQMLPESEDEESYDTESEFTEDEL PYDDCVLGGQRLML NT seq 945 nt NT seq  +upstreamnt  +downstreamnt atgttccagcccgcggagcccggccaggagtgggccatggagggcccccgggacgcgctc aagaaggagcggctgctggacgaccgccacgacagcggcctggactccatgaaggacgag gagtacgagcagatggtgaaagagctgcgggagatccgcctcgagcctcaggaggcgccg cgcggcgccgagccttggaagcagcagctcaccgaggacggagactcgttcctgcacttg gccatcatccatgaagagaaggtgctgaccatggaagtggtccgccaagtgaagggagac ctggcgttcctcaacttccagaacaacctgcagcagactcctctccacttggcagtgatc accaaccagccagaaatcgctgaggcacttctggaagctggctgtgatcctgagctccga gactttcgaggaaatacccccctacaccttgcctgtgagcagggctgcctggccagtgtg ggaatcctgactcagccccgcgggacccagcacctccactccatcctgcaagccaccaac tacaatggtcacacgtgtctgcacttggcctctattcatggctacctgggcatcgtggag ctgttggtgtccttgggtgctgatgtcaacgcacaggagccctgcaatggccgaactgcc ctccatctcgcggttgacctgcagaatcccgacctggtgtcgctcttgttgaagtgtggg gccgatgtcaacagggtcacctaccagggctactctccataccagctcacctggggccgc ccaagcacccggatacagcagcagctgggccagctgaccctagagaaccttcagatgctg cccgagagcgaggatgaggagagctatgacacggagtcagagttcacagaggatgagctg ccctatgatgactgtgtgcttggaggccagcgcctgatgttatga

DBGET integrated database retrieval system