Physeter macrocephalus (sperm whale): 102974009
Help
Entry
102974009 CDS
T06011
Symbol
OSM
Name
(RefSeq) oncostatin-M
KO
K05418
oncostatin M
Organism
pcad
Physeter macrocephalus (sperm whale)
Pathway
pcad04060
Cytokine-cytokine receptor interaction
pcad04151
PI3K-Akt signaling pathway
pcad04630
JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:
pcad00001
]
09130 Environmental Information Processing
09132 Signal transduction
04630 JAK-STAT signaling pathway
102974009 (OSM)
04151 PI3K-Akt signaling pathway
102974009 (OSM)
09133 Signaling molecules and interaction
04060 Cytokine-cytokine receptor interaction
102974009 (OSM)
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
04052 Cytokines and neuropeptides [BR:
pcad04052
]
102974009 (OSM)
Cytokines and neuropeptides [BR:
pcad04052
]
Cytokines
CSF and other factors
102974009 (OSM)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
LIF_OSM
UL73_N
Motif
Other DBs
NCBI-GeneID:
102974009
NCBI-ProteinID:
XP_007128790
UniProt:
A0A2Y9FTH8
LinkDB
All DBs
Position
19:4441746..4445793
Genome browser
AA seq
244 aa
AA seq
DB search
MRAQRMRRTPLSVILGLLFLSVAATSKCSGKYHELLLQLRHQANLMQDTSTLLDPYMRIQ
GLDTPALKDHCRECPGAFPSEDALRGLSRQGFLRTLNATLGLVLHRLTALYQDLPEAQQL
VGLNIRGFRSNIHCMSQLLRSSSEAETPEPTQPSPGPTPPPTPPSDAFQQKLKSCRFLCG
YHRFMHSVGQVLREWGESRSRSRRHSPCRAPGDTALARPCRGGARRTWPFRRDRRLMPRG
QLPR
NT seq
735 nt
NT seq
+upstream
nt +downstream
nt
atgcgggcacagcgtatgcggaggacaccgctcagtgtgatcctcggactcctgttcctg
agcgtggcagccacaagcaagtgctcgggcaagtaccatgaactcctcctgcagctccgg
catcaggcgaatctcatgcaggacaccagcacgctcctggacccctatatgcgcatccaa
ggcctggacacgccagcactgaaggaccactgcagggagtgccccggggccttccccagc
gaggacgccctgcgggggctcagcagacagggcttcctgcggaccctcaatgccacgctg
ggcctcgtcctgcacagactgaccgctttgtatcaggacctccctgaagcccagcagttg
gtgggactgaacatccgcgggttcaggagtaacatccactgcatgtcccagctgctgcgc
agctcctcagaggcggagacacctgagcccactcagccaagccccgggcccacgccgcca
cccacaccgccctcagacgccttccagcaaaagttgaagagctgcaggttcctgtgcggc
taccaccgcttcatgcactctgtggggcaggtcctccgggagtggggggagagccggagc
cggagccggaggcacagcccctgccgggcccctggagacacagccctcgcaaggccctgc
agagggggggcccgcaggacgtggcccttccggagggacaggagactcatgccgagggga
cagctgccccggtag
DBGET
integrated database retrieval system