Physeter macrocephalus (sperm whale): 102975458 Help Entry 102975458         CDS       T06011                                  Symbol JUN Name (RefSeq) transcription factor Jun   KO K04448   transcription factor AP-1 Organism pcad  Physeter macrocephalus (sperm whale) Pathway pcad01522   Endocrine resistance pcad04010   MAPK signaling pathway pcad04012   ErbB signaling pathway pcad04024   cAMP signaling pathway pcad04137   Mitophagy - animal pcad04210   Apoptosis pcad04310   Wnt signaling pathway pcad04380   Osteoclast differentiation pcad04510   Focal adhesion pcad04530   Tight junction pcad04620   Toll-like receptor signaling pathway pcad04621   NOD-like receptor signaling pathway pcad04625   C-type lectin receptor signaling pathway pcad04657   IL-17 signaling pathway pcad04658   Th1 and Th2 cell differentiation pcad04659   Th17 cell differentiation pcad04660   T cell receptor signaling pathway pcad04662   B cell receptor signaling pathway pcad04668   TNF signaling pathway pcad04722   Neurotrophin signaling pathway pcad04912   GnRH signaling pathway pcad04915   Estrogen signaling pathway pcad04921   Oxytocin signaling pathway pcad04926   Relaxin signaling pathway pcad04932   Non-alcoholic fatty liver disease pcad04933   AGE-RAGE signaling pathway in diabetic complications pcad05030   Cocaine addiction pcad05031   Amphetamine addiction pcad05132   Salmonella infection pcad05133   Pertussis pcad05135   Yersinia infection pcad05140   Leishmaniasis pcad05142   Chagas disease pcad05161   Hepatitis B pcad05162   Measles pcad05166   Human T-cell leukemia virus 1 infection pcad05167   Kaposi sarcoma-associated herpesvirus infection pcad05169   Epstein-Barr virus infection pcad05170   Human immunodeficiency virus 1 infection pcad05171   Coronavirus disease - COVID-19 pcad05200   Pathways in cancer pcad05203   Viral carcinogenesis pcad05207   Chemical carcinogenesis - receptor activation pcad05208   Chemical carcinogenesis - reactive oxygen species pcad05210   Colorectal cancer pcad05211   Renal cell carcinoma pcad05224   Breast cancer pcad05231   Choline metabolism in cancer pcad05235   PD-L1 expression and PD-1 checkpoint pathway in cancer pcad05321   Inflammatory bowel disease pcad05323   Rheumatoid arthritis pcad05417   Lipid and atherosclerosis pcad05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pcad00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102975458 (JUN)    04012 ErbB signaling pathway     102975458 (JUN)    04310 Wnt signaling pathway     102975458 (JUN)    04668 TNF signaling pathway     102975458 (JUN)    04024 cAMP signaling pathway     102975458 (JUN)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     102975458 (JUN)   09143 Cell growth and death    04210 Apoptosis     102975458 (JUN)   09144 Cellular community - eukaryotes    04510 Focal adhesion     102975458 (JUN)    04530 Tight junction     102975458 (JUN)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     102975458 (JUN)    04621 NOD-like receptor signaling pathway     102975458 (JUN)    04625 C-type lectin receptor signaling pathway     102975458 (JUN)    04660 T cell receptor signaling pathway     102975458 (JUN)    04658 Th1 and Th2 cell differentiation     102975458 (JUN)    04659 Th17 cell differentiation     102975458 (JUN)    04657 IL-17 signaling pathway     102975458 (JUN)    04662 B cell receptor signaling pathway     102975458 (JUN)   09152 Endocrine system    04912 GnRH signaling pathway     102975458 (JUN)    04915 Estrogen signaling pathway     102975458 (JUN)    04921 Oxytocin signaling pathway     102975458 (JUN)    04926 Relaxin signaling pathway     102975458 (JUN)   09156 Nervous system    04722 Neurotrophin signaling pathway     102975458 (JUN)   09158 Development and regeneration    04380 Osteoclast differentiation     102975458 (JUN)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102975458 (JUN)    05207 Chemical carcinogenesis - receptor activation     102975458 (JUN)    05208 Chemical carcinogenesis - reactive oxygen species     102975458 (JUN)    05203 Viral carcinogenesis     102975458 (JUN)    05231 Choline metabolism in cancer     102975458 (JUN)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     102975458 (JUN)   09162 Cancer: specific types    05210 Colorectal cancer     102975458 (JUN)    05211 Renal cell carcinoma     102975458 (JUN)    05224 Breast cancer     102975458 (JUN)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     102975458 (JUN)    05170 Human immunodeficiency virus 1 infection     102975458 (JUN)    05161 Hepatitis B     102975458 (JUN)    05171 Coronavirus disease - COVID-19     102975458 (JUN)    05162 Measles     102975458 (JUN)    05167 Kaposi sarcoma-associated herpesvirus infection     102975458 (JUN)    05169 Epstein-Barr virus infection     102975458 (JUN)   09171 Infectious disease: bacterial    05132 Salmonella infection     102975458 (JUN)    05135 Yersinia infection     102975458 (JUN)    05133 Pertussis     102975458 (JUN)   09174 Infectious disease: parasitic    05140 Leishmaniasis     102975458 (JUN)    05142 Chagas disease     102975458 (JUN)   09163 Immune disease    05323 Rheumatoid arthritis     102975458 (JUN)    05321 Inflammatory bowel disease     102975458 (JUN)   09165 Substance dependence    05030 Cocaine addiction     102975458 (JUN)    05031 Amphetamine addiction     102975458 (JUN)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102975458 (JUN)    05418 Fluid shear stress and atherosclerosis     102975458 (JUN)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     102975458 (JUN)    04933 AGE-RAGE signaling pathway in diabetic complications     102975458 (JUN)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     102975458 (JUN)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:pcad03000]     102975458 (JUN) Transcription factors [BR:pcad03000]  Eukaryotic type   Basic leucine zipper (bZIP)    AP-1(-like) components, Jun     102975458 (JUN) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Jun bZIP_1 bZIP_2 bZIP_Maf ZapB PspA_IM30 Fib_alpha DUF3450 FlaC_arch Motif Other DBs NCBI-GeneID:  102975458 NCBI-ProteinID:  XP_023975690 Ensembl:  ENSPCTG00005019328 UniProt:  A0A2Y9SHA0 LinkDB All DBs Position Unknown AA seq 338 aa AA seqDB search MTAKMETTFYDDALNASFLQSESGAYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDL LTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAE LHSQNTLPSVTSAAQPVSGAGLVAPAVASVAGGGGGGGGGFGASLHSEPPVYANLSNFNP GALSGGGGGGGAPSYGAAGLAFPAQPQQQPPPPPPHHLPQQIPVQHPRLQALKEEPQTVP EMPGETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSE LASTANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt atgactgcaaagatggaaacgaccttctacgacgatgccctcaacgcctcgttcctccag tccgagagcggcgcctacggctacagtaaccccaagatcctgaagcagagcatgaccctg aacctggccgaccccgtgggcagcctgaagccgcacctcagggccaagaactccgacctt ctcacctcgccagacgtggggctgctcaagctggcgtcgcccgagctggagcgcctgata atccagtccagcaacgggcacatcaccaccacgccgacccccacccagttcctgtgtccc aaaaacgtaacggacgagcaggagggcttcgccgagggcttcgtgcgcgccctggccgaa ctgcacagccagaacacgctgcccagcgtcacgtcggcggcgcagccggtcagcggggcg ggcctggtggctccggccgtggcctcggtggcgggcggcggcggcggcggcggcggcggc ttcggcgccagcctgcacagcgagccgccggtctacgccaacctcagcaacttcaacccg ggcgcgctgagcggcggcggcggtggcggcggggcgccctcctacggcgcggccggcctg gcctttcccgcgcagcctcagcagcagccgccgccgccgccgccgcaccacctgccccag cagatccccgtgcagcacccgcggctgcaggccctgaaggaggagccgcagacggtcccc gagatgcccggggaaacgccgcccctgtcccccatcgacatggagtcccaggagcggatc aaggcggagaggaagcgcatgaggaaccgcatcgctgcctccaagtgccggaaaaggaag ctggagagaatcgcccggctggaggaaaaagtgaaaaccttgaaagcgcagaactcggag ctggcgtccacggccaacatgctcagggaacaggtggcccagcttaagcaaaaagtcatg aaccacgttaacagtgggtgccaactcatgctaacgcagcagttgcaaacgttttga

DBGET integrated database retrieval system