Physeter macrocephalus (sperm whale): 102975625 Help Entry 102975625         CDS       T06011                                  Symbol CCL5 Name (RefSeq) C-C motif chemokine 5   KO K12499   C-C motif chemokine 5 Organism pcad  Physeter macrocephalus (sperm whale) Pathway pcad04060   Cytokine-cytokine receptor interaction pcad04061   Viral protein interaction with cytokine and cytokine receptor pcad04062   Chemokine signaling pathway pcad04620   Toll-like receptor signaling pathway pcad04621   NOD-like receptor signaling pathway pcad04623   Cytosolic DNA-sensing pathway pcad04668   TNF signaling pathway pcad05020   Prion disease pcad05142   Chagas disease pcad05163   Human cytomegalovirus infection pcad05164   Influenza A pcad05168   Herpes simplex virus 1 infection pcad05323   Rheumatoid arthritis pcad05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:pcad00001]  09130 Environmental Information Processing   09132 Signal transduction    04668 TNF signaling pathway     102975625 (CCL5)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102975625 (CCL5)    04061 Viral protein interaction with cytokine and cytokine receptor     102975625 (CCL5)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     102975625 (CCL5)    04621 NOD-like receptor signaling pathway     102975625 (CCL5)    04623 Cytosolic DNA-sensing pathway     102975625 (CCL5)    04062 Chemokine signaling pathway     102975625 (CCL5)  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     102975625 (CCL5)    05168 Herpes simplex virus 1 infection     102975625 (CCL5)    05163 Human cytomegalovirus infection     102975625 (CCL5)   09174 Infectious disease: parasitic    05142 Chagas disease     102975625 (CCL5)   09163 Immune disease    05323 Rheumatoid arthritis     102975625 (CCL5)   09164 Neurodegenerative disease    05020 Prion disease     102975625 (CCL5)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102975625 (CCL5)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pcad04052]     102975625 (CCL5)    00536 Glycosaminoglycan binding proteins [BR:pcad00536]     102975625 (CCL5) Cytokines and neuropeptides [BR:pcad04052]  Cytokines   Chemokines    102975625 (CCL5) Glycosaminoglycan binding proteins [BR:pcad00536]  Heparan sulfate / Heparin   Chemokines    102975625 (CCL5) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  102975625 NCBI-ProteinID:  XP_028355421 Ensembl:  ENSPCTG00005015361 UniProt:  A0A455CAX1 LinkDB All DBs Position 14:complement(99250566..99257185) Genome browser AA seq 91 aa AA seqDB search MKVSAAALAVILAMAALCAPASASPHASDTTPCCFAYLSRPLPRAHLREYFYTSSKCSMA AVVFITRKNRQVCTNPEKKWVQEYINALELS NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgaaggtctccgccgccgccctcgctgtcatcctcgccatggctgccctctgcgctcct gcatctgcctccccacatgcctcggacaccacaccctgctgctttgcctacctctcccgc ccgctgccccgcgcccacctccgggaatatttctacaccagcagcaagtgctccatggca gcagtcgtctttatcaccagaaagaatcgccaggtgtgcaccaacccagagaagaaatgg gtgcaggagtacatcaacgctttagagttgagctag

DBGET integrated database retrieval system