Physeter macrocephalus (sperm whale): 102976552 Help Entry 102976552         CDS       T06011                                  Symbol ELOB Name (RefSeq) elongin-B   KO K03873   elongin-B Organism pcad  Physeter macrocephalus (sperm whale) Pathway pcad04066   HIF-1 signaling pathway pcad04120   Ubiquitin mediated proteolysis pcad05170   Human immunodeficiency virus 1 infection pcad05200   Pathways in cancer pcad05211   Renal cell carcinoma Brite KEGG Orthology (KO) [BR:pcad00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     102976552 (ELOB)  09130 Environmental Information Processing   09132 Signal transduction    04066 HIF-1 signaling pathway     102976552 (ELOB)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102976552 (ELOB)   09162 Cancer: specific types    05211 Renal cell carcinoma     102976552 (ELOB)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     102976552 (ELOB)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:pcad04121]     102976552 (ELOB)    03400 DNA repair and recombination proteins [BR:pcad03400]     102976552 (ELOB) Ubiquitin system [BR:pcad04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      102976552 (ELOB)    Cul5 complex      102976552 (ELOB) DNA repair and recombination proteins [BR:pcad03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      102976552 (ELOB) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  102976552 NCBI-ProteinID:  XP_007100100 Ensembl:  ENSPCTG00005020183 UniProt:  A0A2Y9EEM1 LinkDB All DBs Position 14:48743605..48748047 Genome browser AA seq 158 aa AA seqDB search MAAMGRGRGARGTLGPARGLPGTGRSAAAPARRGAEAAAAMDVFLMIRRHKTTIFTDAKE SSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFR ADEAFEALRIEPFSSPPELPDVMKPQDSGSSANEQAVQ NT seq 477 nt NT seq  +upstreamnt  +downstreamnt atggcggccatggggcggggccgcggggcgcggggcacgctggggccagcgcgcggactg ccgggaacggggcggagcgcggccgcgccggcgcgtcgaggggcagaggcagccgccgcg atggacgtgttcctcatgatccggcgccacaagaccaccatcttcacggacgccaaggag tcgagcactgtgttcgagctaaagcgcatcgtcgagggcatcctcaagcggccgccggac gagcagcggctgtacaaggacgaccagcttctggacgacggaaagacattgggcgagtgt ggcttcaccagccagacagcacggcctcaggccccagccactgtggggctagccttcagg gcagatgaggccttcgaggccctgcgcatcgagcccttctccagcccacccgagctgcca gatgtgatgaagccacaggactcaggaagcagcgccaatgaacaagctgtgcagtga

DBGET integrated database retrieval system