Physeter macrocephalus (sperm whale): 102976606 Help Entry 102976606         CDS       T06011                                  Symbol CSNK2B Name (RefSeq) casein kinase II subunit beta   KO K03115   casein kinase II subunit beta Organism pcad  Physeter macrocephalus (sperm whale) Pathway pcad03008   Ribosome biogenesis in eukaryotes pcad03083   Polycomb repressive complex pcad04064   NF-kappa B signaling pathway pcad04137   Mitophagy - animal pcad04310   Wnt signaling pathway pcad04520   Adherens junction pcad05010   Alzheimer disease pcad05020   Prion disease pcad05022   Pathways of neurodegeneration - multiple diseases pcad05162   Measles pcad05235   PD-L1 expression and PD-1 checkpoint pathway in cancer Brite KEGG Orthology (KO) [BR:pcad00001]  09120 Genetic Information Processing   09122 Translation    03008 Ribosome biogenesis in eukaryotes     102976606 (CSNK2B)   09126 Chromosome    03083 Polycomb repressive complex     102976606 (CSNK2B)  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     102976606 (CSNK2B)    04064 NF-kappa B signaling pathway     102976606 (CSNK2B)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     102976606 (CSNK2B)   09144 Cellular community - eukaryotes    04520 Adherens junction     102976606 (CSNK2B)  09160 Human Diseases   09161 Cancer: overview    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     102976606 (CSNK2B)   09172 Infectious disease: viral    05162 Measles     102976606 (CSNK2B)   09164 Neurodegenerative disease    05010 Alzheimer disease     102976606 (CSNK2B)    05020 Prion disease     102976606 (CSNK2B)    05022 Pathways of neurodegeneration - multiple diseases     102976606 (CSNK2B)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03009 Ribosome biogenesis [BR:pcad03009]     102976606 (CSNK2B)    03036 Chromosome and associated proteins [BR:pcad03036]     102976606 (CSNK2B) Ribosome biogenesis [BR:pcad03009]  Eukaryotic type   90S particles    Kinase     102976606 (CSNK2B) Chromosome and associated proteins [BR:pcad03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.3/1.5)      102976606 (CSNK2B) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CK_II_beta Motif Other DBs NCBI-GeneID:  102976606 NCBI-ProteinID:  XP_007110190 Ensembl:  ENSPCTG00005012562 UniProt:  A0A2Y9EW33 LinkDB All DBs Position 18:complement(85099775..85103846) Genome browser AA seq 215 aa AA seqDB search MSSSEEVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDE ELEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPML PIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPA NQFVPRLYGFKIHPMAYQLQLQAASNFKSPVKTIR NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atgagcagctcagaggaggtgtcctggatttcctggttctgtgggcttcgtggcaatgaa ttcttctgtgaagtggatgaagattatatccaggacaaattcaatctcactggactcaat gagcaggtgcctcactatcgacaagctttagacatgatcttggacctggagcctgatgaa gagctggaagacaaccccaaccagagtgacctgattgagcaggcagctgaaatgctctat ggattgatccacgcccgctatatcctcaccaaccgtggcatcgcccagatgttggaaaag taccagcagggagactttggttactgtccccgtgtgtactgtgagaaccagccaatgctt cccatcggcctttcggacatcccaggtgaggccatggtgaagctctactgccccaagtgc atggacgtgtacacacccaagtcatcgaggcaccaccacacggatggcgcctacttcggc accggtttccctcacatgctcttcatggtgcaccctgagtaccggcccaagaggcccgcc aaccagtttgtgcccaggctctacggtttcaagatccatccgatggcctaccagctgcag ctccaagcggccagcaacttcaagagtccagtcaagacgattcgctga

DBGET integrated database retrieval system