Physeter catodon (sperm whale): 102976718 Help Entry 102976718         CDS       T06011                                  Name (RefSeq) histone H4   KO K11254   histone H4 Organism pcad  Physeter catodon (sperm whale) Pathway pcad04613   Neutrophil extracellular trap formation pcad05034   Alcoholism pcad05203   Viral carcinogenesis pcad05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:pcad00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     102976718  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     102976718   09163 Immune disease    05322 Systemic lupus erythematosus     102976718   09165 Substance dependence    05034 Alcoholism     102976718  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pcad03036]     102976718 Chromosome and associated proteins [BR:pcad03036]  Eukaryotic type   Nucleosome assembly factors    Histones     102976718 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-T_C TAF Histone CENP-S CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137 Motif Other DBs NCBI-GeneID:  102976718 NCBI-ProteinID:  XP_028335242 Ensembl:  ENSPCTG00005017561 UniProt:  A0A2Y9F5G0 LinkDB All DBs Position 18:complement(87254686..87255006) Genome browser AA seq 103 aa AA seqDB search MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgtctggacgtggtaaaggggggaaaggtttggggaaagggggcgccaagcgccaccgc aaagtcctgcgcgacaatatccagggcatcaccaagcccgccatccgccgcctggctcgg cgtggaggtgtcaagcgcatctctggtctcatctacgaggagacccgtggggtgctgaag gtgttcttggagaatgtgatccgggacgctgtcacctacaccgagcatgccaagcgcaag acggtcacggccatggacgtagtctacgcgctcaagcgccagggacgcaccctctacggc ttcggcggctaa

DBGET integrated database retrieval system