Physeter macrocephalus (sperm whale): 102976905 Help Entry 102976905         CDS       T06011                                  Symbol RAB7A Name (RefSeq) ras-related protein Rab-7a   KO K07897   Ras-related protein Rab-7A Organism pcad  Physeter macrocephalus (sperm whale) Pathway pcad04137   Mitophagy - animal pcad04140   Autophagy - animal pcad04144   Endocytosis pcad04145   Phagosome pcad04148   Efferocytosis pcad05132   Salmonella infection pcad05146   Amoebiasis pcad05152   Tuberculosis Brite KEGG Orthology (KO) [BR:pcad00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     102976905 (RAB7A)    04145 Phagosome     102976905 (RAB7A)    04140 Autophagy - animal     102976905 (RAB7A)    04137 Mitophagy - animal     102976905 (RAB7A)    04148 Efferocytosis     102976905 (RAB7A)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     102976905 (RAB7A)    05152 Tuberculosis     102976905 (RAB7A)   09174 Infectious disease: parasitic    05146 Amoebiasis     102976905 (RAB7A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pcad04131]     102976905 (RAB7A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pcad04147]     102976905 (RAB7A)    04031 GTP-binding proteins [BR:pcad04031]     102976905 (RAB7A) Membrane trafficking [BR:pcad04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     102976905 (RAB7A) Exosome [BR:pcad04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102976905 (RAB7A)   Exosomal proteins of other body fluids (saliva and urine)    102976905 (RAB7A)   Exosomal proteins of colorectal cancer cells    102976905 (RAB7A)   Exosomal proteins of bladder cancer cells    102976905 (RAB7A) GTP-binding proteins [BR:pcad04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     102976905 (RAB7A) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase Gtr1_RagA ATP_bind_1 cobW nSTAND3 PduV-EutP Septin AAA_7 NTPase_1 AAA_22 AAA_16 AAA_24 G-alpha AAA_5 ATPase_2 NACHT AAA_14 NB-ARC SRPRB ATP-synt_ab ABC_tran Motif Other DBs NCBI-GeneID:  102976905 NCBI-ProteinID:  XP_007130901 Ensembl:  ENSPCTG00005021510 UniProt:  A0A2Y9FWP9 LinkDB All DBs Position 18:complement(6430818..6499098) Genome browser AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVATKRAQAWCYSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNEFPEPIKLDKNDRAKASAESCSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacctcgaggaagaaagtgctgctgaaggttatcatcctgggagattctggagtcggt aagacatcactcatgaaccagtatgtgaacaagaaattcagtaatcagtacaaagccaca ataggagcagactttctgacaaaggaggtgatggtggatgacagactagttacaatgcag atctgggacacggccggacaggagaggttccagtctctgggtgtggccttctacagaggc gcagactgctgcgtcctggtgttcgacgtgactgcccccaacacgttcaaaaccctcgac agctggagagacgagttcctcatccaggccagtccccgggatccggagaacttccccttc gtcgtgctgggaaacaagattgacctcgaaaacagacaggtggccacgaagcgggcacag gcctggtgctacagcaaaaacaacattccctacttcgagaccagtgccaaggaggccatc aacgtggagcaggccttccagacgattgcccggaacgcgctgaagcaggaaacggaggtg gagctgtacaatgaattccctgagcccatcaaactggacaagaacgaccgggccaaggcc tcggcagaaagctgcagctgctga

DBGET integrated database retrieval system