Physeter macrocephalus (sperm whale): 102976986 Help Entry 102976986         CDS       T06011                                  Name (RefSeq) histone H4   KO K11254   histone H4 Organism pcad  Physeter macrocephalus (sperm whale) Pathway pcad04613   Neutrophil extracellular trap formation pcad05034   Alcoholism pcad05203   Viral carcinogenesis pcad05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:pcad00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     102976986  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     102976986   09163 Immune disease    05322 Systemic lupus erythematosus     102976986   09165 Substance dependence    05034 Alcoholism     102976986  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pcad03036]     102976986 Chromosome and associated proteins [BR:pcad03036]  Eukaryotic type   Nucleosome assembly factors    Histones     102976986 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-T_C TAF Histone CENP-S CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137 Motif Other DBs NCBI-GeneID:  102976986 NCBI-ProteinID:  XP_028335243 Ensembl:  ENSPCTG00005005107 UniProt:  A0A2Y9F5G0 LinkDB All DBs Position 18:complement(87624488..87624878) Genome browser AA seq 103 aa AA seqDB search MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgtctggacgtggcaaaggcgggaagggcttgggtaaagggggcgccaagcgccaccgc aaagtcctgcgggataacattcaagggatcacaaaacctgcaatccgtcgcctggctcgt cgcggtggagtaaagcgcatctcaggtcttatttatgaggaaacccgcggggttctgaaa gtgtttctggagaatgtaattcgggacgcggtcacctataccgagcacgccaagcgcaag actgtcacggccatggacgtggtctacgcgctcaagcgccagggacgcaccctttacgga tttggcggttaa

DBGET integrated database retrieval system