KEGG   Physeter catodon (sperm whale): 102977203
Entry
102977203         CDS       T06011                                 
Symbol
MRAP
Name
(RefSeq) LOW QUALITY PROTEIN: melanocortin-2 receptor accessory protein
  KO
K22398  melanocortin 2 receptor accessory protein
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad04927  Cortisol synthesis and secretion
pcad04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    102977203 (MRAP)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102977203 (MRAP)
SSDB
Motif
Pfam: MRAP DUF1218
Other DBs
NCBI-GeneID: 102977203
NCBI-ProteinID: XP_028349267
UniProt: A0A455BKI4
LinkDB
Position
8:3464224..3480561
AA seq 187 aa
MANRTSASTAYYSYEYYLDYLDLIPVDEKKLKANKHSIVIAFWVSLAAFVVFLLLLLLSM
SWSASPQTRNNAQHHPTCPWSLGLNLPFCVWKQPQHHGAPEGTRRLYRARSRSQVAEHRA
PSSSCSGRVPPPRPPPPPRATLLSSGNWPSMGTRTAPAGVRNFKPSEPPLQTEPLDGRTN
NPNQGHC
NT seq 564 nt   +upstreamnt  +downstreamnt
atggccaaccggaccagtgcctctaccgcatactacagctacgaatactacctggattac
ttggacctcattcccgtggatgagaagaagctgaaagccaacaaacattcgatcgtcatc
gccttctgggtgagcctggcagctttcgtggtgttcctcctcctcttgctgctctccatg
tcctggtcagcctccccgcagacgaggaacaatgcccagcaccacccaacgtgcccctgg
agtctcggcctcaacctccccttctgtgtctggaagcaaccccagcaccacggggccccc
gaggggacccgccgcctctaccgagctcggtcgaggagccaggtggcagagcatcgggcc
ccgtccagcagctgcagcgggagagtccctccacctcggccccctccaccccccagggcc
accctgctctcctctgggaactggccctcgatggggacccgcacagcaccagctggcgtc
aggaacttcaagcccagtgaacctcccctgcagacagaacctctcgatggcagaaccaac
aacccaaaccagggccattgctga

DBGET integrated database retrieval system