Physeter macrocephalus (sperm whale): 102977457 Help Entry 102977457         CDS       T06011                                  Name (RefSeq) cytochrome c 2   KO K08738   cytochrome c Organism pcad  Physeter macrocephalus (sperm whale) Pathway pcad00190   Oxidative phosphorylation pcad01100   Metabolic pathways pcad01524   Platinum drug resistance pcad04115   p53 signaling pathway pcad04210   Apoptosis pcad04215   Apoptosis - multiple species pcad04932   Non-alcoholic fatty liver disease pcad05010   Alzheimer disease pcad05012   Parkinson disease pcad05014   Amyotrophic lateral sclerosis pcad05016   Huntington disease pcad05017   Spinocerebellar ataxia pcad05020   Prion disease pcad05022   Pathways of neurodegeneration - multiple diseases pcad05132   Salmonella infection pcad05134   Legionellosis pcad05145   Toxoplasmosis pcad05152   Tuberculosis pcad05160   Hepatitis C pcad05161   Hepatitis B pcad05162   Measles pcad05163   Human cytomegalovirus infection pcad05164   Influenza A pcad05167   Kaposi sarcoma-associated herpesvirus infection pcad05168   Herpes simplex virus 1 infection pcad05169   Epstein-Barr virus infection pcad05170   Human immunodeficiency virus 1 infection pcad05200   Pathways in cancer pcad05210   Colorectal cancer pcad05222   Small cell lung cancer pcad05416   Viral myocarditis pcad05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:pcad00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     102977457  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     102977457    04215 Apoptosis - multiple species     102977457    04115 p53 signaling pathway     102977457  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102977457   09162 Cancer: specific types    05210 Colorectal cancer     102977457    05222 Small cell lung cancer     102977457   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     102977457    05161 Hepatitis B     102977457    05160 Hepatitis C     102977457    05164 Influenza A     102977457    05162 Measles     102977457    05168 Herpes simplex virus 1 infection     102977457    05163 Human cytomegalovirus infection     102977457    05167 Kaposi sarcoma-associated herpesvirus infection     102977457    05169 Epstein-Barr virus infection     102977457   09171 Infectious disease: bacterial    05132 Salmonella infection     102977457    05134 Legionellosis     102977457    05152 Tuberculosis     102977457   09174 Infectious disease: parasitic    05145 Toxoplasmosis     102977457   09164 Neurodegenerative disease    05010 Alzheimer disease     102977457    05012 Parkinson disease     102977457    05014 Amyotrophic lateral sclerosis     102977457    05016 Huntington disease     102977457    05017 Spinocerebellar ataxia     102977457    05020 Prion disease     102977457    05022 Pathways of neurodegeneration - multiple diseases     102977457   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102977457    05416 Viral myocarditis     102977457   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     102977457   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     102977457 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 CCP_MauG Motif Other DBs NCBI-GeneID:  102977457 NCBI-ProteinID:  XP_007130819 Ensembl:  ENSPCTG00005003686 UniProt:  A0A2Y9FUE5 LinkDB All DBs Position 2:complement(83181703..83208594) Genome browser AA seq 105 aa AA seqDB search MANAEAGKKIFVQKCAQCHTVEKGGKHKTGPNLWGLFGRKTGQAPGFSYTDANKNKGVIW GEETLMEYLENPKKYIPGTKMVFTGLKKKSEREDLIEYLKQATSS NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atggcaaatgctgaggcaggcaagaagatctttgttcaaaaatgtgctcagtgccacaca gtggaaaaaggtggaaaacacaagactggtccaaacctctggggcctttttggcagaaaa acaggacaagcaccaggattttcttataccgatgcaaacaaaaacaaaggtgttatctgg ggagaggagactctgatggaatatttggagaacccaaagaaatatatccctggaactaaa atggtctttactggtcttaaaaagaagagtgagagagaagatcttattgagtatttgaaa caggcaacatcttcatga

DBGET integrated database retrieval system