Physeter macrocephalus (sperm whale): 102978390 Help Entry 102978390         CDS       T06011                                  Symbol GNRH1 Name (RefSeq) progonadoliberin-1   KO K05252   gonadotropin-releasing hormone Organism pcad  Physeter macrocephalus (sperm whale) Pathway pcad04080   Neuroactive ligand-receptor interaction pcad04081   Hormone signaling pcad04912   GnRH signaling pathway pcad04929   GnRH secretion Brite KEGG Orthology (KO) [BR:pcad00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     102978390 (GNRH1)    04081 Hormone signaling     102978390 (GNRH1)  09150 Organismal Systems   09152 Endocrine system    04929 GnRH secretion     102978390 (GNRH1)    04912 GnRH signaling pathway     102978390 (GNRH1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pcad04052]     102978390 (GNRH1) Cytokines and neuropeptides [BR:pcad04052]  Neuropeptides   GPCR binding    102978390 (GNRH1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  GnRH Apolipo_F Motif Other DBs NCBI-GeneID:  102978390 NCBI-ProteinID:  XP_007114030 Ensembl:  ENSPCTG00005001298 UniProt:  A0A2Y9F4J4 LinkDB All DBs Position 9:complement(95700673..95702729) Genome browser AA seq 85 aa AA seqDB search MFLRMEPIPKLLAGLILLTLCVAGCSSQHWSYGLRPGGKRNAENLLDSFQEIAKEVDQPA EPQRFECTIQQRHSPLRDLKGALVS NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgttccttagaatggagccgattccaaaacttctagctggacttatcctgctgactctc tgtgtggcgggctgctccagccagcactggtcctacgggttgcgccccggaggaaagaga aatgctgaaaatctgcttgattctttccaagagatagccaaagaggttgatcaaccagca gaacctcagcgctttgagtgcaccatacagcagcgccattctccactcagggacctgaaa ggagctctggtgagttaa

DBGET integrated database retrieval system