Physeter catodon (sperm whale): 102978607 Help Entry 102978607         CDS       T06011                                  Name (RefSeq) elongin-B-like   KO K03873   elongin-B Organism pcad  Physeter catodon (sperm whale) Pathway pcad04066   HIF-1 signaling pathway pcad04120   Ubiquitin mediated proteolysis pcad05170   Human immunodeficiency virus 1 infection pcad05200   Pathways in cancer pcad05211   Renal cell carcinoma Brite KEGG Orthology (KO) [BR:pcad00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     102978607  09130 Environmental Information Processing   09132 Signal transduction    04066 HIF-1 signaling pathway     102978607  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102978607   09162 Cancer: specific types    05211 Renal cell carcinoma     102978607   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     102978607  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:pcad04121]     102978607    03400 DNA repair and recombination proteins [BR:pcad03400]     102978607 Ubiquitin system [BR:pcad04121]  Ubiquitin ligases (E3)   Multi subunit Ring-finger type E3    Cul2 complex     Adoptor protein      102978607    Cul5 complex      102978607 DNA repair and recombination proteins [BR:pcad03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      102978607 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  102978607 NCBI-ProteinID:  XP_054941731 Ensembl:  ENSPCTG00005018016 UniProt:  A0A9W2WRA4 LinkDB All DBs Position 7:81616867..81617316 Genome browser AA seq 113 aa AA seqDB search MIGLHKTTIFMDAKESSTMFELKRIVQAILKRPLVEQRLYKDDQLLDDRNTLGECGFTSQ TAWPQAPATVGLAFRADEAFEVLHIQPFSRPPELLEVMKPQDRGSSANEQALQ NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atgatcgggctccacaagaccaccatcttcatggatgccaaggagtcgagcaccatgttc gagctgaagcgcattgtccaggccatcctcaagcggccgctggtggagcagcggctgtac aaggacgaccagcttctggatgacagaaatacattgggcgagtgtggcttcaccagccag acagcatggcctcaggccccagccactgtggggctagccttcagggcagatgaagccttt gaggtcctgcatatccagcccttctccagaccacccgagctgctggaggtgatgaagcca caggaccgaggaagcagcgccaatgaacaagctctgcagtga

DBGET integrated database retrieval system