Physeter macrocephalus (sperm whale): 102979508 Help Entry 102979508         CDS       T06011                                  Symbol CSTA Name (RefSeq) cystatin-A   KO K13907   cystatin-A/B Organism pcad  Physeter macrocephalus (sperm whale) Brite KEGG Orthology (KO) [BR:pcad00001]  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:pcad01002]     102979508 (CSTA)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pcad04147]     102979508 (CSTA) Peptidases and inhibitors [BR:pcad01002]  Peptidase inhibitors   Family I25: cystatin family    102979508 (CSTA) Exosome [BR:pcad04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    102979508 (CSTA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cystatin Dynein_light SQAPI Motif Other DBs NCBI-GeneID:  102979508 NCBI-ProteinID:  XP_007112234 Ensembl:  ENSPCTG00005007431 UniProt:  A0A2Y9F030 LinkDB All DBs Position 1:complement(92372420..92384765) Genome browser AA seq 98 aa AA seqDB search MISGGLTEAQPATPEIQEMANTIKPQLEEKTNETYEEFEAVEYKTQVVAGMNYYIKIQVG NDHYIHVKVFKSLPQHNTALALTGYQADKSKDDELMGF NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgatatctggaggcttaactgaagcccaacctgccactccagaaatccaggagatggct aacacgattaaaccacagcttgaagaaaaaacaaatgagacttatgaagaatttgaagct gtggaatataaaactcaagtggttgctggaatgaattactacattaagatacaagtaggt aatgatcattatattcacgtaaaagtattcaaaagccttcctcaacataatacggctttg gcacttactggctaccaggctgacaaaagcaaggacgacgagctcatgggcttctag

DBGET integrated database retrieval system