Physeter catodon (sperm whale): 102979691 Help Entry 102979691         CDS       T06011                                  Symbol CBY1 Name (RefSeq) protein chibby homolog 1   KO K23402   protein chibby 1 Organism pcad  Physeter catodon (sperm whale) Pathway pcad04310   Wnt signaling pathway Brite KEGG Orthology (KO) [BR:pcad00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     102979691 (CBY1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:pcad03037]     102979691 (CBY1) Cilium and associated proteins [BR:pcad03037]  Primary cilia and associated proteins   Other primary cilia associated proteins    102979691 (CBY1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Chibby Motif Other DBs NCBI-GeneID:  102979691 NCBI-ProteinID:  XP_023982924 Ensembl:  ENSPCTG00005008189 UniProt:  A0A2Y9T251 LinkDB All DBs Position 6:44200787..44214200 Genome browser AA seq 127 aa AA seqDB search MPLFGNTFSPKKTPPRKSASLSNLHNLDRSTREVELGLDYGTPTMNLAGQSLKFENGQWI AETGISGGVDRREAQRLRRRNQQLEEENNLLRLKVDILLDMLSETTAESHLMEKELDELK SVSRRRK NT seq 384 nt NT seq  +upstreamnt  +downstreamnt atgcctctctttgggaatacattcagtccgaagaagacgccccctcggaagtctgcgtct ctctccaacctgcataatttggatcggtcgacccgggaggtggagctgggccttgactat ggaacgcccaccatgaacctggccgggcagagcctgaagtttgaaaacggccagtggata gcagagacagggattagtggaggtgtggaccggagggaggcccagcgcctccggaggcgg aaccagcagctggaggaagagaacaatctcttgcggctgaaggtggacatcctgctggac atgctctctgagaccactgccgaatcccacttaatggagaaggagctggatgaactgaag agtgtcagccggcggagaaaatga

DBGET integrated database retrieval system