Physeter macrocephalus (sperm whale): 102979960 Help Entry 102979960         CDS       T06011                                  Symbol CXCL8 Name (RefSeq) interleukin-8   KO K10030   interleukin 8 Organism pcad  Physeter macrocephalus (sperm whale) Pathway pcad04060   Cytokine-cytokine receptor interaction pcad04061   Viral protein interaction with cytokine and cytokine receptor pcad04062   Chemokine signaling pathway pcad04064   NF-kappa B signaling pathway pcad04072   Phospholipase D signaling pathway pcad04218   Cellular senescence pcad04620   Toll-like receptor signaling pathway pcad04621   NOD-like receptor signaling pathway pcad04622   RIG-I-like receptor signaling pathway pcad04657   IL-17 signaling pathway pcad04932   Non-alcoholic fatty liver disease pcad04933   AGE-RAGE signaling pathway in diabetic complications pcad04936   Alcoholic liver disease pcad05132   Salmonella infection pcad05133   Pertussis pcad05134   Legionellosis pcad05135   Yersinia infection pcad05142   Chagas disease pcad05144   Malaria pcad05146   Amoebiasis pcad05161   Hepatitis B pcad05163   Human cytomegalovirus infection pcad05164   Influenza A pcad05167   Kaposi sarcoma-associated herpesvirus infection pcad05171   Coronavirus disease - COVID-19 pcad05200   Pathways in cancer pcad05202   Transcriptional misregulation in cancer pcad05219   Bladder cancer pcad05323   Rheumatoid arthritis pcad05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:pcad00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     102979960 (CXCL8)    04072 Phospholipase D signaling pathway     102979960 (CXCL8)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102979960 (CXCL8)    04061 Viral protein interaction with cytokine and cytokine receptor     102979960 (CXCL8)  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     102979960 (CXCL8)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     102979960 (CXCL8)    04621 NOD-like receptor signaling pathway     102979960 (CXCL8)    04622 RIG-I-like receptor signaling pathway     102979960 (CXCL8)    04657 IL-17 signaling pathway     102979960 (CXCL8)    04062 Chemokine signaling pathway     102979960 (CXCL8)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102979960 (CXCL8)    05202 Transcriptional misregulation in cancer     102979960 (CXCL8)   09162 Cancer: specific types    05219 Bladder cancer     102979960 (CXCL8)   09172 Infectious disease: viral    05161 Hepatitis B     102979960 (CXCL8)    05171 Coronavirus disease - COVID-19     102979960 (CXCL8)    05164 Influenza A     102979960 (CXCL8)    05163 Human cytomegalovirus infection     102979960 (CXCL8)    05167 Kaposi sarcoma-associated herpesvirus infection     102979960 (CXCL8)   09171 Infectious disease: bacterial    05132 Salmonella infection     102979960 (CXCL8)    05135 Yersinia infection     102979960 (CXCL8)    05133 Pertussis     102979960 (CXCL8)    05134 Legionellosis     102979960 (CXCL8)   09174 Infectious disease: parasitic    05146 Amoebiasis     102979960 (CXCL8)    05144 Malaria     102979960 (CXCL8)    05142 Chagas disease     102979960 (CXCL8)   09163 Immune disease    05323 Rheumatoid arthritis     102979960 (CXCL8)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102979960 (CXCL8)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     102979960 (CXCL8)    04932 Non-alcoholic fatty liver disease     102979960 (CXCL8)    04933 AGE-RAGE signaling pathway in diabetic complications     102979960 (CXCL8)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pcad04052]     102979960 (CXCL8)    00536 Glycosaminoglycan binding proteins [BR:pcad00536]     102979960 (CXCL8) Cytokines and neuropeptides [BR:pcad04052]  Cytokines   Chemokines    102979960 (CXCL8) Glycosaminoglycan binding proteins [BR:pcad00536]  Heparan sulfate / Heparin   Chemokines    102979960 (CXCL8) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 CXCL16 DUF5527 Motif Other DBs NCBI-GeneID:  102979960 NCBI-ProteinID:  XP_007126317 Ensembl:  ENSPCTG00005003859 UniProt:  A0A2Y9FM29 LinkDB All DBs Position 7:64686193..64689648 Genome browser AA seq 101 aa AA seqDB search MTSKLAIALLAAFLLSATLCKAAVLSRMSSELRCQCINTHSTPFHPKFIRELRVIESGPH CENSEIIVKLVNGKEVCLNPKEMWVQKVVQIFLKRAEKKDP NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atgacttccaagctggctattgctctcttggcagccttcctgctttctgcaactctgtgt aaagctgcagttctgtcaagaatgagttcagaacttcgatgccaatgcataaatacacac tccacacctttccaccccaaatttatcagagaattgcgagtgattgagagtggaccacac tgtgaaaattcagaaatcattgttaagcttgtcaatggaaaagaggtctgcttaaacccc aaggaaatgtgggtgcagaaggttgtgcagatatttttgaagagagctgagaagaaagat ccatga

DBGET integrated database retrieval system