Physeter macrocephalus (sperm whale): 102980255 Help Entry 102980255         CDS       T06011                                  Name (RefSeq) C-X-C motif chemokine 6   KO K05506   C-X-C motif chemokine 5/6 Organism pcad  Physeter macrocephalus (sperm whale) Pathway pcad04060   Cytokine-cytokine receptor interaction pcad04061   Viral protein interaction with cytokine and cytokine receptor pcad04062   Chemokine signaling pathway pcad04657   IL-17 signaling pathway pcad04668   TNF signaling pathway pcad05133   Pertussis pcad05323   Rheumatoid arthritis Brite KEGG Orthology (KO) [BR:pcad00001]  09130 Environmental Information Processing   09132 Signal transduction    04668 TNF signaling pathway     102980255   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102980255    04061 Viral protein interaction with cytokine and cytokine receptor     102980255  09150 Organismal Systems   09151 Immune system    04657 IL-17 signaling pathway     102980255    04062 Chemokine signaling pathway     102980255  09160 Human Diseases   09171 Infectious disease: bacterial    05133 Pertussis     102980255   09163 Immune disease    05323 Rheumatoid arthritis     102980255  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pcad04052]     102980255 Cytokines and neuropeptides [BR:pcad04052]  Cytokines   Chemokines    102980255 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  102980255 NCBI-ProteinID:  XP_023971215 Ensembl:  ENSPCTG00005003864 UniProt:  A0A2Y9S4Y6 LinkDB All DBs Position 7:64754183..64756415 Genome browser AA seq 113 aa AA seqDB search MRFLCSRAARIPGPSGSLCLLLALLLLTPPGPLASAGPVSAIVRELRCMCLTTTPGIHPK SVSNLQVIAAGPQCSKVEVVATLKNRKEVCLDPEAPLIRKVIQKMLDSGNKKN NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atgagattcctctgcagccgcgccgcccgcatccccggcccttcgggctcgctgtgcttg ctgctcgcgctgctgctgctgacgccgccagggcccctcgccagcgcgggtcctgtctcg gccatagtgagagagctgcgttgcatgtgcttaaccaccacaccggggattcatcccaaa agtgtcagtaatctgcaggtgatcgccgcaggaccgcagtgctccaaggtggaagtggta gccaccttgaagaacagaaaggaagtctgtctggacccagaagctcctctgatcaggaag gtcatccagaaaatgttggacagtggaaacaagaaaaattaa

DBGET integrated database retrieval system