Physeter macrocephalus (sperm whale): 102980282 Help Entry 102980282         CDS       T06011                                  Name (RefSeq) cytochrome c-like   KO K08738   cytochrome c Organism pcad  Physeter macrocephalus (sperm whale) Pathway pcad00190   Oxidative phosphorylation pcad01100   Metabolic pathways pcad01524   Platinum drug resistance pcad04115   p53 signaling pathway pcad04210   Apoptosis pcad04215   Apoptosis - multiple species pcad04932   Non-alcoholic fatty liver disease pcad05010   Alzheimer disease pcad05012   Parkinson disease pcad05014   Amyotrophic lateral sclerosis pcad05016   Huntington disease pcad05017   Spinocerebellar ataxia pcad05020   Prion disease pcad05022   Pathways of neurodegeneration - multiple diseases pcad05132   Salmonella infection pcad05134   Legionellosis pcad05145   Toxoplasmosis pcad05152   Tuberculosis pcad05160   Hepatitis C pcad05161   Hepatitis B pcad05162   Measles pcad05163   Human cytomegalovirus infection pcad05164   Influenza A pcad05167   Kaposi sarcoma-associated herpesvirus infection pcad05168   Herpes simplex virus 1 infection pcad05169   Epstein-Barr virus infection pcad05170   Human immunodeficiency virus 1 infection pcad05200   Pathways in cancer pcad05210   Colorectal cancer pcad05222   Small cell lung cancer pcad05416   Viral myocarditis pcad05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:pcad00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     102980282  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     102980282    04215 Apoptosis - multiple species     102980282    04115 p53 signaling pathway     102980282  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102980282   09162 Cancer: specific types    05210 Colorectal cancer     102980282    05222 Small cell lung cancer     102980282   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     102980282    05161 Hepatitis B     102980282    05160 Hepatitis C     102980282    05164 Influenza A     102980282    05162 Measles     102980282    05168 Herpes simplex virus 1 infection     102980282    05163 Human cytomegalovirus infection     102980282    05167 Kaposi sarcoma-associated herpesvirus infection     102980282    05169 Epstein-Barr virus infection     102980282   09171 Infectious disease: bacterial    05132 Salmonella infection     102980282    05134 Legionellosis     102980282    05152 Tuberculosis     102980282   09174 Infectious disease: parasitic    05145 Toxoplasmosis     102980282   09164 Neurodegenerative disease    05010 Alzheimer disease     102980282    05012 Parkinson disease     102980282    05014 Amyotrophic lateral sclerosis     102980282    05016 Huntington disease     102980282    05017 Spinocerebellar ataxia     102980282    05020 Prion disease     102980282    05022 Pathways of neurodegeneration - multiple diseases     102980282   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102980282    05416 Viral myocarditis     102980282   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     102980282   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     102980282 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Other DBs NCBI-GeneID:  102980282 NCBI-ProteinID:  XP_023980197 UniProt:  A0A2Y9SRX6 LinkDB All DBs Position 1:54331110..54331319 Genome browser AA seq 69 aa AA seqDB search MEKRGKHKTGPNLHGLFGQTRGQAPGFSYTDASKNKGISWGEETLMGYMENPKKYIPGTK MIFTGIRRG NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atggaaaagagaggcaagcacaagactgggccaaatctccatggtctgtttgggcaaacg agaggtcaggcccctggattttcgtacacagatgccagcaagaacaaaggcatctcttgg ggagaggagacactgatggggtatatggagaatcccaagaagtacatccctggaacaaaa atgattttcacaggcattagaaggggctga

DBGET integrated database retrieval system