Physeter macrocephalus (sperm whale): 102980314 Help Entry 102980314         CDS       T06011                                  Name (RefSeq) interferon alpha-1-like   KO K05414   interferon alpha Organism pcad  Physeter macrocephalus (sperm whale) Pathway pcad04060   Cytokine-cytokine receptor interaction pcad04151   PI3K-Akt signaling pathway pcad04217   Necroptosis pcad04620   Toll-like receptor signaling pathway pcad04621   NOD-like receptor signaling pathway pcad04622   RIG-I-like receptor signaling pathway pcad04623   Cytosolic DNA-sensing pathway pcad04630   JAK-STAT signaling pathway pcad04650   Natural killer cell mediated cytotoxicity pcad04936   Alcoholic liver disease pcad05152   Tuberculosis pcad05160   Hepatitis C pcad05161   Hepatitis B pcad05162   Measles pcad05163   Human cytomegalovirus infection pcad05164   Influenza A pcad05165   Human papillomavirus infection pcad05167   Kaposi sarcoma-associated herpesvirus infection pcad05168   Herpes simplex virus 1 infection pcad05169   Epstein-Barr virus infection pcad05170   Human immunodeficiency virus 1 infection pcad05171   Coronavirus disease - COVID-19 pcad05200   Pathways in cancer pcad05320   Autoimmune thyroid disease pcad05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:pcad00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     102980314    04151 PI3K-Akt signaling pathway     102980314   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102980314  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     102980314  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     102980314    04621 NOD-like receptor signaling pathway     102980314    04622 RIG-I-like receptor signaling pathway     102980314    04623 Cytosolic DNA-sensing pathway     102980314    04650 Natural killer cell mediated cytotoxicity     102980314  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102980314   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     102980314    05161 Hepatitis B     102980314    05160 Hepatitis C     102980314    05171 Coronavirus disease - COVID-19     102980314    05164 Influenza A     102980314    05162 Measles     102980314    05168 Herpes simplex virus 1 infection     102980314    05163 Human cytomegalovirus infection     102980314    05167 Kaposi sarcoma-associated herpesvirus infection     102980314    05169 Epstein-Barr virus infection     102980314    05165 Human papillomavirus infection     102980314   09171 Infectious disease: bacterial    05152 Tuberculosis     102980314   09163 Immune disease    05320 Autoimmune thyroid disease     102980314   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102980314   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     102980314  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pcad04052]     102980314 Cytokines and neuropeptides [BR:pcad04052]  Cytokines   Interferons    102980314 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon CoV_NSP2_N Motif Other DBs NCBI-GeneID:  102980314 NCBI-ProteinID:  XP_007121515 Ensembl:  ENSPCTG00005016562 UniProt:  A0A2Y9FFC5 LinkDB All DBs Position 9:63263595..63264351 Genome browser AA seq 226 aa AA seqDB search MGSYLRPRPEGRSSENLESRVLRVPTSARPAAPAGSPMAPTVSLLLALVLLSCNSTCSLG CDLPQTHSLPNTRALMLLQQMRRISPFSCLKDRKDFGFPQEAFGGSQFQKAQAIAVVHEM IQQTFQLFSTEGSAAAWDETLLDKFCTALFQQLTDLQACLMQEAGLEGTPLLKEDSILAV RKYFHGITVYLQEKKYSPCAWEIVRAEVMRSFSSSANLQERLRRKE NT seq 681 nt NT seq  +upstreamnt  +downstreamnt atgggttcctatttaagacccaggcctgaaggaaggtcttcagagaacctagagagcagg gttctcagagtccccacctcagccaggccggcagcacctgcagggtccccgatggcccca accgtgtccttactcctggccctggtgctgctcagctgcaactccacgtgctctctgggc tgcgacctgcctcagacccacagcctgcctaacacgagggccctgatgctcctgcaacaa atgaggagaatctcccccttctcctgcctgaaggacagaaaggactttggattcccccag gaggcgtttggtggcagccagttccagaaggctcaagccatcgccgtcgtccatgagatg atccagcagaccttccagctcttcagcacggagggctcggctgccgcctgggatgagacc ctcctggacaagttctgcactgcactttttcagcagctcactgacctgcaagcctgtctg atgcaggaggcggggctggaagggactcccctgctgaaggaggactccatcctggctgtg aggaaatacttccacggaatcactgtctatctgcaagagaagaagtacagcccttgtgcc tgggagattgtcagagcagaagtcatgagatccttctcttcatcagcaaacttgcaagaa agactcaggaggaaggaatga

DBGET integrated database retrieval system