Physeter macrocephalus (sperm whale): 102982335 Help Entry 102982335         CDS       T06011                                  Symbol IL12A Name (RefSeq) interleukin-12 subunit alpha   KO K05406   interleukin 12A Organism pcad  Physeter macrocephalus (sperm whale) Pathway pcad04060   Cytokine-cytokine receptor interaction pcad04620   Toll-like receptor signaling pathway pcad04622   RIG-I-like receptor signaling pathway pcad04625   C-type lectin receptor signaling pathway pcad04630   JAK-STAT signaling pathway pcad04658   Th1 and Th2 cell differentiation pcad04936   Alcoholic liver disease pcad04940   Type I diabetes mellitus pcad05133   Pertussis pcad05134   Legionellosis pcad05140   Leishmaniasis pcad05142   Chagas disease pcad05143   African trypanosomiasis pcad05144   Malaria pcad05145   Toxoplasmosis pcad05146   Amoebiasis pcad05152   Tuberculosis pcad05162   Measles pcad05164   Influenza A pcad05168   Herpes simplex virus 1 infection pcad05171   Coronavirus disease - COVID-19 pcad05200   Pathways in cancer pcad05321   Inflammatory bowel disease pcad05330   Allograft rejection pcad05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:pcad00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     102982335 (IL12A)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102982335 (IL12A)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     102982335 (IL12A)    04622 RIG-I-like receptor signaling pathway     102982335 (IL12A)    04625 C-type lectin receptor signaling pathway     102982335 (IL12A)    04658 Th1 and Th2 cell differentiation     102982335 (IL12A)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102982335 (IL12A)   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     102982335 (IL12A)    05164 Influenza A     102982335 (IL12A)    05162 Measles     102982335 (IL12A)    05168 Herpes simplex virus 1 infection     102982335 (IL12A)   09171 Infectious disease: bacterial    05133 Pertussis     102982335 (IL12A)    05134 Legionellosis     102982335 (IL12A)    05152 Tuberculosis     102982335 (IL12A)   09174 Infectious disease: parasitic    05146 Amoebiasis     102982335 (IL12A)    05144 Malaria     102982335 (IL12A)    05145 Toxoplasmosis     102982335 (IL12A)    05140 Leishmaniasis     102982335 (IL12A)    05142 Chagas disease     102982335 (IL12A)    05143 African trypanosomiasis     102982335 (IL12A)   09163 Immune disease    05321 Inflammatory bowel disease     102982335 (IL12A)    05330 Allograft rejection     102982335 (IL12A)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102982335 (IL12A)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     102982335 (IL12A)    04936 Alcoholic liver disease     102982335 (IL12A)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pcad04052]     102982335 (IL12A)    00536 Glycosaminoglycan binding proteins [BR:pcad00536]     102982335 (IL12A) Cytokines and neuropeptides [BR:pcad04052]  Cytokines   Interleukins    102982335 (IL12A) Glycosaminoglycan binding proteins [BR:pcad00536]  Heparan sulfate / Heparin   Cytokines    102982335 (IL12A) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL12 DUF327 Motif Other DBs NCBI-GeneID:  102982335 NCBI-ProteinID:  XP_007110613 Ensembl:  ENSPCTG00005004147 UniProt:  A0A2Y9EXX9 LinkDB All DBs Position 1:54611092..54618094 Genome browser AA seq 222 aa AA seqDB search MCPPRSLLLVAILVLLHRLDHLSLARNLPATTAGPGMFQCLNHSQNLLRAVSNTLQKARQ TLEFYSCTSEEIDHEDITKDRTSTVEACLPLELATNESCLASRKTSLITNGSCLASRKSS FMMTLCLSSIYEDLKMYHMEFQAMNAKLLMDPKRQIFLDQNMLAAIAELMQALNSHSKTV SQKPSLEELDFYKTKIKLCILLHAFRIRVVTIDRMMSYLSSS NT seq 669 nt NT seq  +upstreamnt  +downstreamnt atgtgcccgccgcgcagcctcctccttgtggccatcctggtcctcctccaccgcctggac cacttgagtttggccaggaacctccccgccaccacagcgggccccggaatgttccagtgc ctcaaccactcccaaaacctgctgagagccgtcagcaacacccttcagaaggccagacaa accctagaattttactcctgcacttctgaagagattgatcatgaagatatcaccaaagat agaaccagcacagtggaggcctgcttaccactggaattagccacgaatgagagttgcctg gcttccagaaagacctctttaataactaatgggagttgcctggcttccagaaagagctct tttatgatgaccctgtgccttagcagtatctatgaggacttgaagatgtaccacatggag ttccaggccatgaatgcaaagcttctgatggatcctaagaggcagatctttctggatcag aacatgctggcagctattgctgagctgatgcaggccctgaattcccacagcaagactgtg tcacagaaaccctccctggaagaactggatttttataagactaaaatcaagctctgcata cttcttcatgccttcagaattcgtgtggtgaccatcgacagaatgatgagctatctgagt tcttcctaa

DBGET integrated database retrieval system