Physeter macrocephalus (sperm whale): 102982395 Help Entry 102982395         CDS       T06011                                  Name (RefSeq) metallothionein-2-like   KO K14739   metallothionein 1/2 Organism pcad  Physeter macrocephalus (sperm whale) Pathway pcad04978   Mineral absorption Brite KEGG Orthology (KO) [BR:pcad00001]  09150 Organismal Systems   09154 Digestive system    04978 Mineral absorption     102982395  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:pcad03019]     102982395    03029 Mitochondrial biogenesis [BR:pcad03029]     102982395 Messenger RNA biogenesis [BR:pcad03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      102982395 Mitochondrial biogenesis [BR:pcad03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Nuclear respiratory factors     102982395 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Metallothio Motif Other DBs NCBI-GeneID:  102982395 NCBI-ProteinID:  XP_054939710 UniProt:  A0A9W2WKM3 LinkDB All DBs Position 3:complement(18652003..18652400) Genome browser AA seq 61 aa AA seqDB search MDPNCSCTAGGSCTCAGSCKCKECKCTSCKKSCCSCCPVSYAKCAQGCVCKGASDEGSCC A NT seq 186 nt NT seq  +upstreamnt  +downstreamnt atggatcccaactgctcctgcaccgcaggtggatcctgcacgtgtgccggctcctgcaaa tgcaaagagtgcaaatgcacctcctgcaagaagagctgctgctcctgctgccccgtgagc tatgccaagtgtgcccagggctgcgtctgcaaaggggcctcggacgagggcagctgctgc gcctga

DBGET integrated database retrieval system