Physeter macrocephalus (sperm whale): 102983656 Help Entry 102983656         CDS       T06011                                  Symbol HMGB1 Name (RefSeq) high mobility group protein B1   KO K10802   high mobility group protein B1 Organism pcad  Physeter macrocephalus (sperm whale) Pathway pcad03410   Base excision repair pcad04140   Autophagy - animal pcad04217   Necroptosis pcad04613   Neutrophil extracellular trap formation Brite KEGG Orthology (KO) [BR:pcad00001]  09120 Genetic Information Processing   09124 Replication and repair    03410 Base excision repair     102983656 (HMGB1)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     102983656 (HMGB1)   09143 Cell growth and death    04217 Necroptosis     102983656 (HMGB1)  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     102983656 (HMGB1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pcad03036]     102983656 (HMGB1)    03400 DNA repair and recombination proteins [BR:pcad03400]     102983656 (HMGB1)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pcad04147]     102983656 (HMGB1) Chromosome and associated proteins [BR:pcad03036]  Eukaryotic type   Nucleosome assembly factors    HMG (high mobility group) proteins     102983656 (HMGB1) DNA repair and recombination proteins [BR:pcad03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Other BER factors      102983656 (HMGB1)    MMR (mismatch excision repair)     Other MMR factors      102983656 (HMGB1) Exosome [BR:pcad04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    102983656 (HMGB1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  HMG_box_2 HMG_box HMG_WDHD1 NOA36 HMG_box_5 Nop14 Motif Other DBs NCBI-GeneID:  102983656 NCBI-ProteinID:  XP_007115054 Ensembl:  ENSPCTG00005015034 UniProt:  A0A2Y9F6C7 LinkDB All DBs Position 13:complement(7683381..7690289) Genome browser AA seq 215 aa AA seqDB search MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKF EDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGL SIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEK SKKKKEEEEDEEDEEDEEEEEDEEDEEEEEDDDDE NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atgggcaaaggagatcctaagaagccgagaggcaaaatgtcatcctatgcgttctttgtg caaacgtgccgggaggagcacaaaaagaagcacccagacgcttccgtcaacttctcagag ttttcgaagaagtgctcggagcggtggaagaccatgtctgctaaagagaaaggaaagttt gaagacatggcaaaggcggacaaggcccgttatgaaagagaaatgaaaacttatatccct cctaaaggggaaacaaaaaagaagttcaaggatcccaatgcacccaagaggcctccttcg gcctttttcttgttttgttctgagtatcgtccaaaaatcaaaggagaacatcctggccta tccattggcgatgttgcaaagaagctgggagagatgtggaataacaccgctgcagatgac aagcagccgtatgagaagaaggctgctaagctgaaggagaagtacgaaaaggatattgct gcataccgagctaaagggaagcctgatgcagcaaaaaagggagtcgtcaaggctgaaaaa agcaagaaaaagaaggaagaggaggaagatgaggaagatgaagaggatgaggaggaggag gaagatgaagaggatgaagaggaagaagaagatgatgatgatgaataa

DBGET integrated database retrieval system