Physeter macrocephalus (sperm whale): 102984294 Help Entry 102984294         CDS       T06011                                  Name (RefSeq) histone H2B type 1-A-like   KO K11252   histone H2B Organism pcad  Physeter macrocephalus (sperm whale) Pathway pcad04613   Neutrophil extracellular trap formation pcad05034   Alcoholism pcad05203   Viral carcinogenesis pcad05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:pcad00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     102984294  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     102984294   09163 Immune disease    05322 Systemic lupus erythematosus     102984294   09165 Substance dependence    05034 Alcoholism     102984294  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pcad03036]     102984294   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pcad04147]     102984294 Chromosome and associated proteins [BR:pcad03036]  Eukaryotic type   Nucleosome assembly factors    Histones     102984294 Exosome [BR:pcad04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102984294 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF DUF3915 Motif Other DBs NCBI-GeneID:  102984294 NCBI-ProteinID:  XP_007128689 Ensembl:  ENSPCTG00005005799 UniProt:  A0A2Y9FSI1 LinkDB All DBs Position 18:87949746..87950129 Genome browser AA seq 127 aa AA seqDB search MPEENGKGSVSSKKGFKKAVTKTQKKEEKKRERCCKESNSLYICKVLKQVHPDTGISSKA MSTINFSVTGIFERFAAEASRLVHYNKRSTITSGEIQTAVRLLLPGELVKRAVSEGAKAV TKYSGSK NT seq 384 nt NT seq  +upstreamnt  +downstreamnt atgccagaggagaatggtaaaggcagtgttagttctaagaaaggtttcaaaaaagccgtg actaaaactcagaaaaaggaggagaaaaagcgcgagagatgttgcaaagagagcaattca ctctatatctgtaaggtattaaaacaagttcatccggatactggtatttcttcgaaggct atgagcactataaatttttctgttactggtatatttgagcgtttcgcggcggaggcgtcc cgcctggtgcattacaacaagcgttcgaccatcacatctggggagatccagacagcagtg cgcttgctgcttcctggggaattggtcaagcgcgcagtgtccgagggcgccaaggctgtc actaagtacagtggttccaaataa

DBGET integrated database retrieval system