KEGG   Physeter macrocephalus (sperm whale): 102984305
Entry
102984305         CDS       T06011                                 
Symbol
MAPK1
Name
(RefSeq) mitogen-activated protein kinase 1
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
pcad  Physeter macrocephalus (sperm whale)
Pathway
pcad01521  EGFR tyrosine kinase inhibitor resistance
pcad01522  Endocrine resistance
pcad01524  Platinum drug resistance
pcad04010  MAPK signaling pathway
pcad04012  ErbB signaling pathway
pcad04014  Ras signaling pathway
pcad04015  Rap1 signaling pathway
pcad04022  cGMP-PKG signaling pathway
pcad04024  cAMP signaling pathway
pcad04062  Chemokine signaling pathway
pcad04066  HIF-1 signaling pathway
pcad04068  FoxO signaling pathway
pcad04071  Sphingolipid signaling pathway
pcad04072  Phospholipase D signaling pathway
pcad04114  Oocyte meiosis
pcad04140  Autophagy - animal
pcad04148  Efferocytosis
pcad04150  mTOR signaling pathway
pcad04151  PI3K-Akt signaling pathway
pcad04210  Apoptosis
pcad04218  Cellular senescence
pcad04261  Adrenergic signaling in cardiomyocytes
pcad04270  Vascular smooth muscle contraction
pcad04350  TGF-beta signaling pathway
pcad04360  Axon guidance
pcad04370  VEGF signaling pathway
pcad04371  Apelin signaling pathway
pcad04380  Osteoclast differentiation
pcad04510  Focal adhesion
pcad04520  Adherens junction
pcad04540  Gap junction
pcad04550  Signaling pathways regulating pluripotency of stem cells
pcad04611  Platelet activation
pcad04613  Neutrophil extracellular trap formation
pcad04620  Toll-like receptor signaling pathway
pcad04621  NOD-like receptor signaling pathway
pcad04625  C-type lectin receptor signaling pathway
pcad04650  Natural killer cell mediated cytotoxicity
pcad04657  IL-17 signaling pathway
pcad04658  Th1 and Th2 cell differentiation
pcad04659  Th17 cell differentiation
pcad04660  T cell receptor signaling pathway
pcad04662  B cell receptor signaling pathway
pcad04664  Fc epsilon RI signaling pathway
pcad04666  Fc gamma R-mediated phagocytosis
pcad04668  TNF signaling pathway
pcad04713  Circadian entrainment
pcad04720  Long-term potentiation
pcad04722  Neurotrophin signaling pathway
pcad04723  Retrograde endocannabinoid signaling
pcad04724  Glutamatergic synapse
pcad04725  Cholinergic synapse
pcad04726  Serotonergic synapse
pcad04730  Long-term depression
pcad04810  Regulation of actin cytoskeleton
pcad04910  Insulin signaling pathway
pcad04912  GnRH signaling pathway
pcad04914  Progesterone-mediated oocyte maturation
pcad04915  Estrogen signaling pathway
pcad04916  Melanogenesis
pcad04917  Prolactin signaling pathway
pcad04919  Thyroid hormone signaling pathway
pcad04921  Oxytocin signaling pathway
pcad04926  Relaxin signaling pathway
pcad04928  Parathyroid hormone synthesis, secretion and action
pcad04929  GnRH secretion
pcad04930  Type II diabetes mellitus
pcad04933  AGE-RAGE signaling pathway in diabetic complications
pcad04934  Cushing syndrome
pcad04935  Growth hormone synthesis, secretion and action
pcad04960  Aldosterone-regulated sodium reabsorption
pcad05010  Alzheimer disease
pcad05020  Prion disease
pcad05022  Pathways of neurodegeneration - multiple diseases
pcad05034  Alcoholism
pcad05132  Salmonella infection
pcad05133  Pertussis
pcad05135  Yersinia infection
pcad05140  Leishmaniasis
pcad05142  Chagas disease
pcad05145  Toxoplasmosis
pcad05152  Tuberculosis
pcad05160  Hepatitis C
pcad05161  Hepatitis B
pcad05163  Human cytomegalovirus infection
pcad05164  Influenza A
pcad05165  Human papillomavirus infection
pcad05166  Human T-cell leukemia virus 1 infection
pcad05167  Kaposi sarcoma-associated herpesvirus infection
pcad05170  Human immunodeficiency virus 1 infection
pcad05171  Coronavirus disease - COVID-19
pcad05200  Pathways in cancer
pcad05203  Viral carcinogenesis
pcad05205  Proteoglycans in cancer
pcad05206  MicroRNAs in cancer
pcad05207  Chemical carcinogenesis - receptor activation
pcad05208  Chemical carcinogenesis - reactive oxygen species
pcad05210  Colorectal cancer
pcad05211  Renal cell carcinoma
pcad05212  Pancreatic cancer
pcad05213  Endometrial cancer
pcad05214  Glioma
pcad05215  Prostate cancer
pcad05216  Thyroid cancer
pcad05218  Melanoma
pcad05219  Bladder cancer
pcad05220  Chronic myeloid leukemia
pcad05221  Acute myeloid leukemia
pcad05223  Non-small cell lung cancer
pcad05224  Breast cancer
pcad05225  Hepatocellular carcinoma
pcad05226  Gastric cancer
pcad05230  Central carbon metabolism in cancer
pcad05231  Choline metabolism in cancer
pcad05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pcad05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102984305 (MAPK1)
   04012 ErbB signaling pathway
    102984305 (MAPK1)
   04014 Ras signaling pathway
    102984305 (MAPK1)
   04015 Rap1 signaling pathway
    102984305 (MAPK1)
   04350 TGF-beta signaling pathway
    102984305 (MAPK1)
   04370 VEGF signaling pathway
    102984305 (MAPK1)
   04371 Apelin signaling pathway
    102984305 (MAPK1)
   04668 TNF signaling pathway
    102984305 (MAPK1)
   04066 HIF-1 signaling pathway
    102984305 (MAPK1)
   04068 FoxO signaling pathway
    102984305 (MAPK1)
   04072 Phospholipase D signaling pathway
    102984305 (MAPK1)
   04071 Sphingolipid signaling pathway
    102984305 (MAPK1)
   04024 cAMP signaling pathway
    102984305 (MAPK1)
   04022 cGMP-PKG signaling pathway
    102984305 (MAPK1)
   04151 PI3K-Akt signaling pathway
    102984305 (MAPK1)
   04150 mTOR signaling pathway
    102984305 (MAPK1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102984305 (MAPK1)
   04148 Efferocytosis
    102984305 (MAPK1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    102984305 (MAPK1)
   04210 Apoptosis
    102984305 (MAPK1)
   04218 Cellular senescence
    102984305 (MAPK1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102984305 (MAPK1)
   04520 Adherens junction
    102984305 (MAPK1)
   04540 Gap junction
    102984305 (MAPK1)
   04550 Signaling pathways regulating pluripotency of stem cells
    102984305 (MAPK1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102984305 (MAPK1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102984305 (MAPK1)
   04613 Neutrophil extracellular trap formation
    102984305 (MAPK1)
   04620 Toll-like receptor signaling pathway
    102984305 (MAPK1)
   04621 NOD-like receptor signaling pathway
    102984305 (MAPK1)
   04625 C-type lectin receptor signaling pathway
    102984305 (MAPK1)
   04650 Natural killer cell mediated cytotoxicity
    102984305 (MAPK1)
   04660 T cell receptor signaling pathway
    102984305 (MAPK1)
   04658 Th1 and Th2 cell differentiation
    102984305 (MAPK1)
   04659 Th17 cell differentiation
    102984305 (MAPK1)
   04657 IL-17 signaling pathway
    102984305 (MAPK1)
   04662 B cell receptor signaling pathway
    102984305 (MAPK1)
   04664 Fc epsilon RI signaling pathway
    102984305 (MAPK1)
   04666 Fc gamma R-mediated phagocytosis
    102984305 (MAPK1)
   04062 Chemokine signaling pathway
    102984305 (MAPK1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102984305 (MAPK1)
   04929 GnRH secretion
    102984305 (MAPK1)
   04912 GnRH signaling pathway
    102984305 (MAPK1)
   04915 Estrogen signaling pathway
    102984305 (MAPK1)
   04914 Progesterone-mediated oocyte maturation
    102984305 (MAPK1)
   04917 Prolactin signaling pathway
    102984305 (MAPK1)
   04921 Oxytocin signaling pathway
    102984305 (MAPK1)
   04926 Relaxin signaling pathway
    102984305 (MAPK1)
   04935 Growth hormone synthesis, secretion and action
    102984305 (MAPK1)
   04919 Thyroid hormone signaling pathway
    102984305 (MAPK1)
   04928 Parathyroid hormone synthesis, secretion and action
    102984305 (MAPK1)
   04916 Melanogenesis
    102984305 (MAPK1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102984305 (MAPK1)
   04270 Vascular smooth muscle contraction
    102984305 (MAPK1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    102984305 (MAPK1)
  09156 Nervous system
   04724 Glutamatergic synapse
    102984305 (MAPK1)
   04725 Cholinergic synapse
    102984305 (MAPK1)
   04726 Serotonergic synapse
    102984305 (MAPK1)
   04720 Long-term potentiation
    102984305 (MAPK1)
   04730 Long-term depression
    102984305 (MAPK1)
   04723 Retrograde endocannabinoid signaling
    102984305 (MAPK1)
   04722 Neurotrophin signaling pathway
    102984305 (MAPK1)
  09158 Development and regeneration
   04360 Axon guidance
    102984305 (MAPK1)
   04380 Osteoclast differentiation
    102984305 (MAPK1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102984305 (MAPK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102984305 (MAPK1)
   05206 MicroRNAs in cancer
    102984305 (MAPK1)
   05205 Proteoglycans in cancer
    102984305 (MAPK1)
   05207 Chemical carcinogenesis - receptor activation
    102984305 (MAPK1)
   05208 Chemical carcinogenesis - reactive oxygen species
    102984305 (MAPK1)
   05203 Viral carcinogenesis
    102984305 (MAPK1)
   05230 Central carbon metabolism in cancer
    102984305 (MAPK1)
   05231 Choline metabolism in cancer
    102984305 (MAPK1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102984305 (MAPK1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102984305 (MAPK1)
   05212 Pancreatic cancer
    102984305 (MAPK1)
   05225 Hepatocellular carcinoma
    102984305 (MAPK1)
   05226 Gastric cancer
    102984305 (MAPK1)
   05214 Glioma
    102984305 (MAPK1)
   05216 Thyroid cancer
    102984305 (MAPK1)
   05221 Acute myeloid leukemia
    102984305 (MAPK1)
   05220 Chronic myeloid leukemia
    102984305 (MAPK1)
   05218 Melanoma
    102984305 (MAPK1)
   05211 Renal cell carcinoma
    102984305 (MAPK1)
   05219 Bladder cancer
    102984305 (MAPK1)
   05215 Prostate cancer
    102984305 (MAPK1)
   05213 Endometrial cancer
    102984305 (MAPK1)
   05224 Breast cancer
    102984305 (MAPK1)
   05223 Non-small cell lung cancer
    102984305 (MAPK1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102984305 (MAPK1)
   05170 Human immunodeficiency virus 1 infection
    102984305 (MAPK1)
   05161 Hepatitis B
    102984305 (MAPK1)
   05160 Hepatitis C
    102984305 (MAPK1)
   05171 Coronavirus disease - COVID-19
    102984305 (MAPK1)
   05164 Influenza A
    102984305 (MAPK1)
   05163 Human cytomegalovirus infection
    102984305 (MAPK1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102984305 (MAPK1)
   05165 Human papillomavirus infection
    102984305 (MAPK1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102984305 (MAPK1)
   05135 Yersinia infection
    102984305 (MAPK1)
   05133 Pertussis
    102984305 (MAPK1)
   05152 Tuberculosis
    102984305 (MAPK1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102984305 (MAPK1)
   05140 Leishmaniasis
    102984305 (MAPK1)
   05142 Chagas disease
    102984305 (MAPK1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102984305 (MAPK1)
   05020 Prion disease
    102984305 (MAPK1)
   05022 Pathways of neurodegeneration - multiple diseases
    102984305 (MAPK1)
  09165 Substance dependence
   05034 Alcoholism
    102984305 (MAPK1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    102984305 (MAPK1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    102984305 (MAPK1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102984305 (MAPK1)
   04934 Cushing syndrome
    102984305 (MAPK1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102984305 (MAPK1)
   01524 Platinum drug resistance
    102984305 (MAPK1)
   01522 Endocrine resistance
    102984305 (MAPK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pcad01001]
    102984305 (MAPK1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pcad03036]
    102984305 (MAPK1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pcad04147]
    102984305 (MAPK1)
Enzymes [BR:pcad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     102984305 (MAPK1)
Protein kinases [BR:pcad01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   102984305 (MAPK1)
Chromosome and associated proteins [BR:pcad03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     102984305 (MAPK1)
Exosome [BR:pcad04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102984305 (MAPK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH STATB_N Haspin_kinase FTA2 Kdo
Other DBs
NCBI-GeneID: 102984305
NCBI-ProteinID: XP_023976242
Ensembl: ENSPCTG00005013879
UniProt: A0A2Y9SG06
LinkDB
Position
19:complement(2133988..2233339)
AA seq 359 aa
MAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEH
QTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHL
SNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHT
GFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHIL
GILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKR
IEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
NT seq 1080 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggcgggcgcgggccccgagatggtccgcgggcaggtgtttgatgtg
gggccgcgctacaccaacctctcttacatcggcgagggcgcctacggcatggtgtgctct
gcttatgataatgtcaacaaagttcgagtagctatcaagaaaatcagcccttttgagcac
cagacctactgccagagaaccctgagggagataaaaatcttactgcgcttcagacatgag
aacatcattggaatcaatgatattattcgagcaccaaccatcgagcagatgaaagatgta
tatatagtacaggacctcatggaaacagatctctacaagctcttgaagacgcaacacctc
agcaacgaccatatctgctattttctttaccagatcctcagagggttaaaatatatccat
tcagctaacgtgctgcaccgtgacctcaaaccttccaacctgctgctcaacaccacctgc
gatctcaagatctgtgactttggcttggcccgtgttgcagatccggaccatgatcacaca
gggttcctgacggagtacgttgccacacgttggtacagggctccagaaattatgttgaat
tccaagggctacaccaagtccattgatatttggtctgtaggctgcatcctggcagagatg
ctctctaacaggcccatcttcccggggaagcattacctcgaccagctgaaccacattctg
ggtattcttggatccccatcccaggaagacctgaattgtataataaatttaaaagctaga
aactatttgctttctcttccgcacaaaaataaggtgccatggaacaggctgttcccaaat
gctgactccaaagctctggatttactggacaagatgttgacattcaaccctcataagagg
attgaggtggaacaggctctggcccacccgtacctggagcagtactacgacccaagtgat
gagccaatcgccgaagcaccgttcaagtttgacatggaattggatgacttgcccaaggaa
aagctcaaagaactcatttttgaagagaccgcgagattccagccaggatacagatcttaa

DBGET integrated database retrieval system