Physeter macrocephalus (sperm whale): 102984411 Help Entry 102984411         CDS       T06011                                  Symbol PFN4 Name (RefSeq) profilin-4 isoform X1   KO K05759   profilin Organism pcad  Physeter macrocephalus (sperm whale) Pathway pcad04015   Rap1 signaling pathway pcad04810   Regulation of actin cytoskeleton pcad05014   Amyotrophic lateral sclerosis pcad05132   Salmonella infection Brite KEGG Orthology (KO) [BR:pcad00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     102984411 (PFN4)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     102984411 (PFN4)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     102984411 (PFN4)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     102984411 (PFN4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pcad04131]     102984411 (PFN4)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:pcad04812]     102984411 (PFN4)    04147 Exosome [BR:pcad04147]     102984411 (PFN4) Membrane trafficking [BR:pcad04131]  Others   Actin-binding proteins    Others     102984411 (PFN4) Cytoskeleton proteins [BR:pcad04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      102984411 (PFN4) Exosome [BR:pcad04147]  Exosomal proteins   Proteins found in most exosomes    102984411 (PFN4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  102984411 NCBI-ProteinID:  XP_007114822 Ensembl:  ENSPCTG00005018269 UniProt:  A0A2Y9F474 LinkDB All DBs Position 12:complement(43362601..43371752) Genome browser AA seq 133 aa AA seqDB search MSHLQNLLLDTLLGTKHVDGAALIKLQEHSLCVASPGFSVMPSDVQTLVNGFAKNPLKTR REGLYFKEKDYKCVRADDYSLYAKSENTGVVVVKTHLYLLVATYTEGMYPSVCVEATEKL GKFVPNACLCSLW NT seq 402 nt NT seq  +upstreamnt  +downstreamnt atgagccatttgcagaacttgctgttagatacactcctgggaacaaagcatgtagacggt gcagccctcatcaaactccaggagcacagcctatgtgtagcatcacctggatttagtgta atgcccagtgatgtccaaacacttgtgaatggatttgccaagaaccctttgaaaaccaga agagaaggattgtatttcaaggagaaggactacaaatgtgtccgggcagatgactattct ctttatgctaagagtgaaaacactggtgtggttgttgtgaagacccatctgtatcttctg gtggcaacttacactgagggcatgtatcctagtgtctgtgtggaagccacagagaaattg ggtaagtttgttcccaatgcctgcctttgttccctgtggtag

DBGET integrated database retrieval system