Physeter macrocephalus (sperm whale): 102984579 Help Entry 102984579         CDS       T06011                                  Name (RefSeq) AP-2 complex subunit sigma-like   KO K11827   AP-2 complex subunit sigma-1 Organism pcad  Physeter macrocephalus (sperm whale) Pathway pcad04144   Endocytosis pcad04721   Synaptic vesicle cycle pcad04961   Endocrine and other factor-regulated calcium reabsorption pcad05016   Huntington disease Brite KEGG Orthology (KO) [BR:pcad00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     102984579  09150 Organismal Systems   09155 Excretory system    04961 Endocrine and other factor-regulated calcium reabsorption     102984579   09156 Nervous system    04721 Synaptic vesicle cycle     102984579  09160 Human Diseases   09164 Neurodegenerative disease    05016 Huntington disease     102984579  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pcad04131]     102984579 Membrane trafficking [BR:pcad04131]  Endocytosis   Clathrin-mediated endocytosis    AP-2 complex     102984579 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Clat_adaptor_s GBD_ELAPOR1 DUF6994 Motif Other DBs NCBI-GeneID:  102984579 NCBI-ProteinID:  XP_054940642 Ensembl:  ENSPCTG00005006930 UniProt:  A0A9W2WNA0 LinkDB All DBs Position 5:complement(49773472..49773891) Genome browser AA seq 105 aa AA seqDB search MICFILIQNLVGKTHLVKWYMQFDDNEKPKLIEEVHATSHCWRCQNTNFVEILNKYCDNV CELSAFTSKVYSVTDLTLVTSKICETSQMKVLKLQSLESMPGDHL NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atgatctgcttcatcctcatccagaacctggtgggcaagacacatctggtcaagtggtac atgcagtttgatgacaatgagaaaccaaagttgatagaggaggtgcacgccaccagtcac tgttggagatgccaaaacaccaactttgtggagatcttaaacaaatattgcgacaatgtt tgtgaactgtctgcttttacatccaaggtttattcagtgacagacttaacattggtgact agtaagatctgtgagaccagccagatgaaggtgctgaaactccagtccctggagtccatg cctggggaccacctctga

DBGET integrated database retrieval system