Physeter macrocephalus (sperm whale): 102984866 Help Entry 102984866         CDS       T06011                                  Symbol RAB5C Name (RefSeq) ras-related protein Rab-5C   KO K07889   Ras-related protein Rab-5C Organism pcad  Physeter macrocephalus (sperm whale) Pathway pcad04014   Ras signaling pathway pcad04137   Mitophagy - animal pcad04144   Endocytosis pcad04145   Phagosome pcad04148   Efferocytosis pcad04962   Vasopressin-regulated water reabsorption pcad05132   Salmonella infection pcad05146   Amoebiasis pcad05152   Tuberculosis Brite KEGG Orthology (KO) [BR:pcad00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     102984866 (RAB5C)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     102984866 (RAB5C)    04145 Phagosome     102984866 (RAB5C)    04137 Mitophagy - animal     102984866 (RAB5C)    04148 Efferocytosis     102984866 (RAB5C)  09150 Organismal Systems   09155 Excretory system    04962 Vasopressin-regulated water reabsorption     102984866 (RAB5C)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     102984866 (RAB5C)    05152 Tuberculosis     102984866 (RAB5C)   09174 Infectious disease: parasitic    05146 Amoebiasis     102984866 (RAB5C)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pcad04131]     102984866 (RAB5C)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pcad04147]     102984866 (RAB5C)    04031 GTP-binding proteins [BR:pcad04031]     102984866 (RAB5C) Membrane trafficking [BR:pcad04131]  Endocytosis   Rab GTPases and associated proteins    Rab GTPases     102984866 (RAB5C)  Endosome - Lysosome transport     102984866 (RAB5C) Exosome [BR:pcad04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102984866 (RAB5C)   Exosomal proteins of other body fluids (saliva and urine)    102984866 (RAB5C)   Exosomal proteins of colorectal cancer cells    102984866 (RAB5C)   Exosomal proteins of bladder cancer cells    102984866 (RAB5C) GTP-binding proteins [BR:pcad04031]  Small (monomeric) G-proteins   Rab Family    Rab5/17/22/31 [OT]     102984866 (RAB5C) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA MMR_HSR1 RsgA_GTPase AAA_16 Motif Other DBs NCBI-GeneID:  102984866 NCBI-ProteinID:  XP_007129112 Ensembl:  ENSPCTG00005021130 UniProt:  A0A2Y9FRI0 LinkDB All DBs Position Unknown AA seq 216 aa AA seqDB search MAGRGGAARPNGPAAGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLT QTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQ RQASPNIVIALAGNKADLASKRAVEFQEAQAYAEDNSLLFMETSAKTAMNVNEIFMAIAK KLPKNEPQNTACAPGRNRGVDLQENNPASRSQCCSN NT seq 651 nt NT seq  +upstreamnt  +downstreamnt atggcgggtcggggaggtgcagcacgacccaacggaccggctgctgggaacaagatctgt cagtttaagctggtcctgctgggggagtccgcagtgggcaaatccagcctcgtcctccgc tttgtcaagggtcaattccacgagtaccaggagagcaccattggagcggccttcctcaca cagaccgtctgcttggacgacacaacagtcaagtttgagatctgggacacagctggacag gagcggtatcacagcctggcccccatgtactatcggggggcccaggctgccatcgtggtc tacgacatcaccaacacagatacgtttgcgcgggccaagaactgggtgaaggagttgcag aggcaggccagccccaacatcgtcatcgcgctcgcgggcaacaaggccgacctggccagc aagagagccgtggagttccaggaagcacaagcctatgcagaggacaacagtttgctgttt atggagacatcagcaaagactgcgatgaacgtgaatgaaattttcatggcaatagctaag aagcttcccaagaacgagccccagaatacagcttgtgctccgggccggaaccgaggagtg gacctccaggagaacaaccctgccagccggagccagtgctgcagcaactga

DBGET integrated database retrieval system