Physeter macrocephalus (sperm whale): 102985344 Help Entry 102985344         CDS       T06011                                  Symbol GSTA4 Name (RefSeq) glutathione S-transferase A4   KO K00799   glutathione S-transferase [EC:2.5.1.18] Organism pcad  Physeter macrocephalus (sperm whale) Pathway pcad00480   Glutathione metabolism pcad00980   Metabolism of xenobiotics by cytochrome P450 pcad00982   Drug metabolism - cytochrome P450 pcad00983   Drug metabolism - other enzymes pcad01100   Metabolic pathways pcad01524   Platinum drug resistance pcad05200   Pathways in cancer pcad05204   Chemical carcinogenesis - DNA adducts pcad05207   Chemical carcinogenesis - receptor activation pcad05208   Chemical carcinogenesis - reactive oxygen species pcad05225   Hepatocellular carcinoma pcad05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pcad00001]  09100 Metabolism   09106 Metabolism of other amino acids    00480 Glutathione metabolism     102985344 (GSTA4)   09111 Xenobiotics biodegradation and metabolism    00980 Metabolism of xenobiotics by cytochrome P450     102985344 (GSTA4)    00982 Drug metabolism - cytochrome P450     102985344 (GSTA4)    00983 Drug metabolism - other enzymes     102985344 (GSTA4)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102985344 (GSTA4)    05204 Chemical carcinogenesis - DNA adducts     102985344 (GSTA4)    05207 Chemical carcinogenesis - receptor activation     102985344 (GSTA4)    05208 Chemical carcinogenesis - reactive oxygen species     102985344 (GSTA4)   09162 Cancer: specific types    05225 Hepatocellular carcinoma     102985344 (GSTA4)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     102985344 (GSTA4)   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     102985344 (GSTA4)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:pcad02000]     102985344 (GSTA4) Enzymes [BR:pcad01000]  2. Transferases   2.5  Transferring alkyl or aryl groups, other than methyl groups    2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)     2.5.1.18  glutathione transferase      102985344 (GSTA4) Transporters [BR:pcad02000]  Other transporters   Pores ion channels [TC:1]    102985344 (GSTA4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  GST_C_3 GST_C GST_N GST_C_2 GST_N_2 GST_N_3 Motif Other DBs NCBI-GeneID:  102985344 NCBI-ProteinID:  XP_007130257 Ensembl:  ENSPCTG00005004750 UniProt:  A0A2Y9FTK7 LinkDB All DBs Position 18:complement(84070564..84091282) Genome browser AA seq 223 aa AA seqDB search MMATKPKLHYPNGRGRMESVRWVLAAAGVEFDEEFLETKEQLQKLQDGNHLLFQQVPMVE IDGMKLVQTRSILHYIADKHHLFGKDLKERTLIDMYVEGTLDLLELIIMHPFLKPDDQQK EVVNMAQKAIIRYFPVFEKVLRGHGQRFLVGNQLSLADIILLQTILALEEKIPNILSAFP HLQEFTVKISNIPTIKKFLEPGSKRKPPPDDIYVRTVYNIFMP NT seq 672 nt NT seq  +upstreamnt  +downstreamnt atgatggctacgaagcccaaactccactacccaaatggacgaggccggatggaatccgtg cgatgggttttagctgccgctggagtcgagtttgatgaagaatttttagaaacaaaagaa cagttgcagaagttgcaggatggtaaccacctgctgttccaacaagtgccaatggttgaa attgatgggatgaagctagtgcagacccgcagcatcctccactatatagcggacaagcac catctcttcggcaaagatctcaaggagagaaccctgattgacatgtatgtggaggggacc ctggatcttctggaactgattatcatgcatcctttcctcaaaccagacgatcagcaaaag gaagtggtgaacatggcccagaaggctataattagatactttcctgtgttcgaaaaggtt ttacggggtcatggacaaaggtttcttgttggtaatcagctgagccttgcagacataatt ctactccagaccattttggctctagaagagaaaattcctaatatcctgtctgcctttcct cacctccaggagttcacagtgaaaataagtaatatccctacaattaagaaattccttgaa cctggcagcaagaggaagcctcctccggatgacatctacgtgagaaccgtgtacaacatc ttcatgccgtag

DBGET integrated database retrieval system