Physeter macrocephalus (sperm whale): 102986000 Help Entry 102986000         CDS       T06011                                  Symbol RRAS Name (RefSeq) ras-related protein R-Ras   KO K07829   Ras-related protein R-Ras Organism pcad  Physeter macrocephalus (sperm whale) Pathway pcad04010   MAPK signaling pathway pcad04014   Ras signaling pathway pcad04015   Rap1 signaling pathway pcad04024   cAMP signaling pathway pcad04072   Phospholipase D signaling pathway pcad04137   Mitophagy - animal pcad04140   Autophagy - animal pcad04218   Cellular senescence pcad04360   Axon guidance pcad04371   Apelin signaling pathway pcad04519   Cadherin signaling pcad04625   C-type lectin receptor signaling pathway pcad04810   Regulation of actin cytoskeleton pcad05132   Salmonella infection pcad05205   Proteoglycans in cancer Brite KEGG Orthology (KO) [BR:pcad00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102986000 (RRAS)    04014 Ras signaling pathway     102986000 (RRAS)    04015 Rap1 signaling pathway     102986000 (RRAS)    04371 Apelin signaling pathway     102986000 (RRAS)    04072 Phospholipase D signaling pathway     102986000 (RRAS)    04024 cAMP signaling pathway     102986000 (RRAS)   09133 Signaling molecules and interaction    04519 Cadherin signaling     102986000 (RRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     102986000 (RRAS)    04137 Mitophagy - animal     102986000 (RRAS)   09143 Cell growth and death    04218 Cellular senescence     102986000 (RRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     102986000 (RRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     102986000 (RRAS)   09158 Development and regeneration    04360 Axon guidance     102986000 (RRAS)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     102986000 (RRAS)   09171 Infectious disease: bacterial    05132 Salmonella infection     102986000 (RRAS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:pcad04031]     102986000 (RRAS) GTP-binding proteins [BR:pcad04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     102986000 (RRAS) SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 ATP_bind_1 AAA_22 Motif Other DBs NCBI-GeneID:  102986000 NCBI-ProteinID:  XP_007112497 Ensembl:  ENSPCTG00005010605 UniProt:  A0A2Y9F214 LinkDB All DBs Position 17:complement(11816498..11820614) Genome browser AA seq 218 aa AA seqDB search MSSGAASGTGRGRPRGGGPGPGDPPPSETHKLVVVGGGGVGKSALTIQFIQSYFVSDYDP TIEDSYTKICMVDGVPARLDILDTAGQEEFGAMREQYMRAGHGFLLVFAINDRQSFNEVG KLFTQILRVKDRDDFPIVLVGNKADLETQRQVPRSEASTFSASHHVAYFEASAKLRLNVD EAFEQLVRAVRKYQEQELPPCPPSAPRKKDGGCPCVLL NT seq 657 nt NT seq  +upstreamnt  +downstreamnt atgagcagcggggcggcgtccgggacagggcgggggcggccccggggcggggggccgggg cccggggaccccccacccagcgagacacacaagctggtggtcgtgggcggcggcggcgtg ggcaagagcgcgctgaccatccagttcatccagtcctacttcgtgtctgactacgacccc actattgaagactcctacacgaagatctgcatggtggatggcgtcccagcccggctagac attctggacaccgctggccaggaggagttcggtgctatgcgggaacagtacatgcgcgcc ggccacggcttcctgctggtgtttgccattaacgaccggcagagtttcaacgaggtgggc aagctcttcacgcagatcctccgagtcaaggaccgagatgacttccccatcgtgttggtc gggaacaaggcagatctggagacacagcgccaggtcccccgatccgaagcctccaccttc agcgcctcccaccacgtggcctacttcgaggcctcggccaaactgcgcctcaatgtggac gaggccttcgagcagctggtgcgggccgtccggaagtaccaggaacaagagctcccgccc tgcccgcccagcgcccccaggaagaaggacgggggttgcccctgcgtcctcctgtag

DBGET integrated database retrieval system