Physeter macrocephalus (sperm whale): 102986070 Help Entry 102986070         CDS       T06011                                  Name (RefSeq) histone H3.3A   KO K11253   histone H3 Organism pcad  Physeter macrocephalus (sperm whale) Pathway pcad04613   Neutrophil extracellular trap formation pcad05034   Alcoholism pcad05202   Transcriptional misregulation in cancer pcad05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:pcad00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     102986070  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     102986070   09163 Immune disease    05322 Systemic lupus erythematosus     102986070   09165 Substance dependence    05034 Alcoholism     102986070  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pcad03036]     102986070   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pcad04147]     102986070 Chromosome and associated proteins [BR:pcad03036]  Eukaryotic type   Nucleosome assembly factors    Histones     102986070 Exosome [BR:pcad04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102986070 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CENP-T_C PAF CENP-S CBFD_NFYB_HMF TFIID-31kDa Motif Other DBs NCBI-GeneID:  102986070 NCBI-ProteinID:  XP_007128127 Ensembl:  ENSPCTG00005000927 UniProt:  A0A2Y9FPM9 LinkDB All DBs Position 4:23950324..23958742 Genome browser AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctcgtacaaagcagactgcccgcaaatcgaccggtggtaaagcaccgaggaagcaa ctggctacaaaagccgctcgcaagagtgcgccctctactggaggggtgaagaaacctcat cgttacaggcctggtaccgtggcactccgtgaaattaggcgttatcagaagtccactgaa cttctgattcgcaaacttcccttccagcgtctggtgcgggaaattgctcaggacttcaaa acagatctccgcttccagagtgcagctattggtgctttgcaggaggcaagtgaggcctat ctggttggcctttttgaagacaccaacctgtgtgctatccatgccaaacgtgtaacgatt atgccaaaagacatccagctagcgcgccgcatacgtggagaacgtgcttaa

DBGET integrated database retrieval system