Physeter macrocephalus (sperm whale): 102986078
Help
Entry
102986078 CDS
T06011
Symbol
CREB3L4
Name
(RefSeq) cyclic AMP-responsive element-binding protein 3-like protein 4 isoform X3
KO
K09048
cyclic AMP-responsive element-binding protein 3
Organism
pcad
Physeter macrocephalus (sperm whale)
Pathway
pcad04022
cGMP-PKG signaling pathway
pcad04024
cAMP signaling pathway
pcad04151
PI3K-Akt signaling pathway
pcad04152
AMPK signaling pathway
pcad04211
Longevity regulating pathway
pcad04261
Adrenergic signaling in cardiomyocytes
pcad04668
TNF signaling pathway
pcad04714
Thermogenesis
pcad04725
Cholinergic synapse
pcad04728
Dopaminergic synapse
pcad04911
Insulin secretion
pcad04915
Estrogen signaling pathway
pcad04916
Melanogenesis
pcad04918
Thyroid hormone synthesis
pcad04922
Glucagon signaling pathway
pcad04925
Aldosterone synthesis and secretion
pcad04926
Relaxin signaling pathway
pcad04927
Cortisol synthesis and secretion
pcad04928
Parathyroid hormone synthesis, secretion and action
pcad04931
Insulin resistance
pcad04934
Cushing syndrome
pcad04935
Growth hormone synthesis, secretion and action
pcad04962
Vasopressin-regulated water reabsorption
pcad05016
Huntington disease
pcad05020
Prion disease
pcad05030
Cocaine addiction
pcad05031
Amphetamine addiction
pcad05034
Alcoholism
pcad05161
Hepatitis B
pcad05163
Human cytomegalovirus infection
pcad05165
Human papillomavirus infection
pcad05166
Human T-cell leukemia virus 1 infection
pcad05203
Viral carcinogenesis
pcad05207
Chemical carcinogenesis - receptor activation
pcad05215
Prostate cancer
Brite
KEGG Orthology (KO) [BR:
pcad00001
]
09130 Environmental Information Processing
09132 Signal transduction
04668 TNF signaling pathway
102986078 (CREB3L4)
04024 cAMP signaling pathway
102986078 (CREB3L4)
04022 cGMP-PKG signaling pathway
102986078 (CREB3L4)
04151 PI3K-Akt signaling pathway
102986078 (CREB3L4)
04152 AMPK signaling pathway
102986078 (CREB3L4)
09150 Organismal Systems
09152 Endocrine system
04911 Insulin secretion
102986078 (CREB3L4)
04922 Glucagon signaling pathway
102986078 (CREB3L4)
04915 Estrogen signaling pathway
102986078 (CREB3L4)
04926 Relaxin signaling pathway
102986078 (CREB3L4)
04935 Growth hormone synthesis, secretion and action
102986078 (CREB3L4)
04918 Thyroid hormone synthesis
102986078 (CREB3L4)
04928 Parathyroid hormone synthesis, secretion and action
102986078 (CREB3L4)
04916 Melanogenesis
102986078 (CREB3L4)
04925 Aldosterone synthesis and secretion
102986078 (CREB3L4)
04927 Cortisol synthesis and secretion
102986078 (CREB3L4)
09153 Circulatory system
04261 Adrenergic signaling in cardiomyocytes
102986078 (CREB3L4)
09155 Excretory system
04962 Vasopressin-regulated water reabsorption
102986078 (CREB3L4)
09156 Nervous system
04725 Cholinergic synapse
102986078 (CREB3L4)
04728 Dopaminergic synapse
102986078 (CREB3L4)
09149 Aging
04211 Longevity regulating pathway
102986078 (CREB3L4)
09159 Environmental adaptation
04714 Thermogenesis
102986078 (CREB3L4)
09160 Human Diseases
09161 Cancer: overview
05207 Chemical carcinogenesis - receptor activation
102986078 (CREB3L4)
05203 Viral carcinogenesis
102986078 (CREB3L4)
09162 Cancer: specific types
05215 Prostate cancer
102986078 (CREB3L4)
09172 Infectious disease: viral
05166 Human T-cell leukemia virus 1 infection
102986078 (CREB3L4)
05161 Hepatitis B
102986078 (CREB3L4)
05163 Human cytomegalovirus infection
102986078 (CREB3L4)
05165 Human papillomavirus infection
102986078 (CREB3L4)
09164 Neurodegenerative disease
05016 Huntington disease
102986078 (CREB3L4)
05020 Prion disease
102986078 (CREB3L4)
09165 Substance dependence
05030 Cocaine addiction
102986078 (CREB3L4)
05031 Amphetamine addiction
102986078 (CREB3L4)
05034 Alcoholism
102986078 (CREB3L4)
09167 Endocrine and metabolic disease
04931 Insulin resistance
102986078 (CREB3L4)
04934 Cushing syndrome
102986078 (CREB3L4)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03000 Transcription factors [BR:
pcad03000
]
102986078 (CREB3L4)
Transcription factors [BR:
pcad03000
]
Eukaryotic type
Basic leucine zipper (bZIP)
CREB
102986078 (CREB3L4)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
bZIP_1
bZIP_2
bZIP_Maf
ZapB
HAUS-augmin3
OppC_N
Motif
Other DBs
NCBI-GeneID:
102986078
NCBI-ProteinID:
XP_007130344
Ensembl:
ENSPCTG00005015751
UniProt:
A0A2Y9FWL3
LinkDB
All DBs
Position
Unknown
AA seq
395 aa
AA seq
DB search
MDFRTPDLLEMWLEPPEDVFSTGSFLELGLHGPPSEVPVTRLQEQGLQGWESSGGHGCGL
QESEPEDFLKLFIDPNEVYCSEASPGSDSGISEDPRHPDSPPAPKPPSSPALYEVVYEAG
TLERMQGEAGPAVGLISIQIDQWSPPFMVPDACVVSEPPPDAHAHILPRAGTVNSVPPAA
LLPCQTLFLTEEEKRLLGQEGVSLPPHLPLTKAEERVLKKVRRKIRNKQSAQDSRRRKKE
YIDGLESRVAACSAQNQELQKKVQELERHNISLVTQLRQLQMLIVQTSNKAAQTSTCVLI
LLFSLALIILPSFSPFQGLPEAGPEDYQPHGVISRNILTHKDMTENLENPAVESRLEGPP
GAKGVNGSTRTLLEKTGGRAGPSRHIRTVLHADEM
NT seq
1188 nt
NT seq
+upstream
nt +downstream
nt
atggatttcagaacccctgacctgctggaaatgtggctggagcctccagaagacgtcttc
tcaacaggatccttcctggagctgggactccatggtccaccttcagaggtcccagtaact
aggctacaggaacaggggctgcaaggctgggagtccagtgggggccatggctgtggtctt
caagagagtgagcctgaagatttcctgaaacttttcattgatcctaatgaagtgtactgc
tcagaagcatctcctggcagtgacagtggaatctctgaggatcctcgccatccagacagt
ccccctgcccccaagccacccagttcccctgccctctatgaggttgtctatgaggcaggg
accctggagaggatgcagggggaagctgggccagctgtagggctcatctccatccaaata
gatcagtggagcccaccatttatggtgcccgatgcctgtgtggtcagtgagccgcctccc
gatgctcatgcccacatcctgcccagagcaggcactgtaaactcagtgcctcctgcagcc
ctgctgccctgtcaaaccttgttcctgacagaagaggagaagcgtctgctgggacaggaa
ggggtgtccctaccccctcacctgcccctcaccaaggcagaggagagggtcctcaagaag
gtcaggaggaaaatccgtaacaagcagtcagctcaggacagtcggcggcggaagaaagag
tacatcgatggactagagagcagggtggctgcctgttctgcacagaaccaggaactacag
aaaaaagtccaggagctggagaggcacaacatctccctggtgactcagctccgccagctg
cagatgcttattgttcaaacctccaacaaagctgcccagactagcacttgtgttctgatc
cttcttttctccttggctctcatcatcctgcccagtttcagcccctttcagggcttacca
gaagctgggcctgaggattaccagcctcacggagtgatttccagaaacatcctgactcac
aaggacatgacagaaaatctggagaatccagcggtagagtccagattggaggggccacct
ggggccaagggtgtaaatggctcaacaaggacactgcttgagaagacaggagggagggca
ggccccagcaggcacatcagaactgtgttgcatgcagatgagatgtga
DBGET
integrated database retrieval system