Physeter macrocephalus (sperm whale): 102986543 Help Entry 102986543         CDS       T06011                                  Name (RefSeq) histone H2B type 2-E-like   KO K11252   histone H2B Organism pcad  Physeter macrocephalus (sperm whale) Pathway pcad04613   Neutrophil extracellular trap formation pcad05034   Alcoholism pcad05203   Viral carcinogenesis pcad05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:pcad00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     102986543  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     102986543   09163 Immune disease    05322 Systemic lupus erythematosus     102986543   09165 Substance dependence    05034 Alcoholism     102986543  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pcad03036]     102986543   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pcad04147]     102986543 Chromosome and associated proteins [BR:pcad03036]  Eukaryotic type   Nucleosome assembly factors    Histones     102986543 Exosome [BR:pcad04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102986543 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like ARM_TT21 Motif Other DBs NCBI-GeneID:  102986543 NCBI-ProteinID:  XP_054936084 UniProt:  A0A9W2W9Y0 LinkDB All DBs Position 18:complement(87583053..87583650) Genome browser AA seq 116 aa AA seqDB search MPEPAKSASAPKKGSKKAKRKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDI FERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atgcctgagccagcgaagtctgcttctgctccgaaaaagggctctaaaaaggcgaagcgc aagcgcagtcgcaaggagagctactctatctacgtgtacaaagtgttgaagcaggtccac ccggacaccggcatctcgtccaaggccatgggcatcatgaactcgtttgtcaacgacatt ttcgagcgcatcgcgggcgaggcgtcgcgcctggcgcattataacaagcgttcgaccatc acgtcgagggagatccagacggccgtgcgcctgttgttgcccggggagttggccaagcat gccgtgtccgagggcaccaaggctgttaccaagtacaccagctccaaataa

DBGET integrated database retrieval system