Physeter macrocephalus (sperm whale): 102986761
Help
Entry
102986761 CDS
T06011
Symbol
WNT3A
Name
(RefSeq) protein Wnt-3a
KO
K00312
wingless-type MMTV integration site family, member 3
Organism
pcad
Physeter macrocephalus (sperm whale)
Pathway
pcad04150
mTOR signaling pathway
pcad04310
Wnt signaling pathway
pcad04390
Hippo signaling pathway
pcad04550
Signaling pathways regulating pluripotency of stem cells
pcad04916
Melanogenesis
pcad04934
Cushing syndrome
pcad05010
Alzheimer disease
pcad05022
Pathways of neurodegeneration - multiple diseases
pcad05165
Human papillomavirus infection
pcad05200
Pathways in cancer
pcad05205
Proteoglycans in cancer
pcad05206
MicroRNAs in cancer
pcad05217
Basal cell carcinoma
pcad05224
Breast cancer
pcad05225
Hepatocellular carcinoma
pcad05226
Gastric cancer
Brite
KEGG Orthology (KO) [BR:
pcad00001
]
09130 Environmental Information Processing
09132 Signal transduction
04310 Wnt signaling pathway
102986761 (WNT3A)
04390 Hippo signaling pathway
102986761 (WNT3A)
04150 mTOR signaling pathway
102986761 (WNT3A)
09140 Cellular Processes
09144 Cellular community - eukaryotes
04550 Signaling pathways regulating pluripotency of stem cells
102986761 (WNT3A)
09150 Organismal Systems
09152 Endocrine system
04916 Melanogenesis
102986761 (WNT3A)
09160 Human Diseases
09161 Cancer: overview
05200 Pathways in cancer
102986761 (WNT3A)
05206 MicroRNAs in cancer
102986761 (WNT3A)
05205 Proteoglycans in cancer
102986761 (WNT3A)
09162 Cancer: specific types
05225 Hepatocellular carcinoma
102986761 (WNT3A)
05226 Gastric cancer
102986761 (WNT3A)
05217 Basal cell carcinoma
102986761 (WNT3A)
05224 Breast cancer
102986761 (WNT3A)
09172 Infectious disease: viral
05165 Human papillomavirus infection
102986761 (WNT3A)
09164 Neurodegenerative disease
05010 Alzheimer disease
102986761 (WNT3A)
05022 Pathways of neurodegeneration - multiple diseases
102986761 (WNT3A)
09167 Endocrine and metabolic disease
04934 Cushing syndrome
102986761 (WNT3A)
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
00536 Glycosaminoglycan binding proteins [BR:
pcad00536
]
102986761 (WNT3A)
Glycosaminoglycan binding proteins [BR:
pcad00536
]
Heparan sulfate / Heparin
Morphogens
102986761 (WNT3A)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
wnt
DUF6973
Motif
Other DBs
NCBI-GeneID:
102986761
NCBI-ProteinID:
XP_007113972
Ensembl:
ENSPCTG00005001738
UniProt:
A0A2Y9F2M4
LinkDB
All DBs
Position
2:11331692..11379151
Genome browser
AA seq
352 aa
AA seq
DB search
MAPLGYFIFLYGLKQALGNYPIWWSLAVGPQYSSLGTQPILCASIPGLVPKQLRFCRNYV
EIMPSVAEGIKISIQECQHQFRGRRWNCTTVNNSLAIFGPVLDKATRESAFVHAIASAGV
AFAVTRSCAEGSAAICGCSSRHQGSPGEGWKWGGCSEDIEFGGMVSREFADARENRPDAR
SAMNRHNNEAGRQAIASHMHLKCKCHGLSGSCEVKTCWWSQPDFRAIGDFLKDKYDSASE
MVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEASPNFCEPNPETGSFGTRDRTCNVS
SHGIDGCDLLCCGRGHNARTERRREKCHCVFHWCCYVSCQECARIYDVHTCK
NT seq
1059 nt
NT seq
+upstream
nt +downstream
nt
atggccccgctcggatatttcatattcctctacggcctgaagcaagcgctgggcaactac
ccgatctggtggtccctggctgtcgggccccagtactcatccctggggacacagcccatc
ctctgcgccagcatcccaggcctggtacccaagcagctgcgtttctgccggaactacgtg
gagatcatgcccagtgtggcagagggcatcaagatcagcatccaggagtgccaacaccag
ttccgtggccgccggtggaattgcaccactgtcaacaacagcctggccatctttggccct
gtgctggacaaagccacccgggagtccgcctttgtgcacgccatcgcctccgccggcgta
gccttcgctgtgacacgctcgtgcgccgagggctccgctgccatctgcggctgcagcagc
cgccaccagggctcgccgggtgagggctggaagtggggcggctgcagtgaggacatcgag
ttcggagggatggtgtctcgggagttcgcagacgcgcgggagaaccgaccagacgctcgc
tccgccatgaaccgccacaacaatgaggctgggcgccaggccatcgccagccacatgcac
ctcaagtgcaagtgccatgggctctccggcagctgtgaggtgaagacctgctggtggtcg
cagcccgacttccgtgccattggtgacttcctcaaggacaagtatgacagcgcctcggag
atggtggtggagaagcaccgcgagtcacgcggctgggtggagaccctgcggccacgctac
acctacttcaaggtgcccacagagcgcgacctggtctactacgaggcctcgcccaacttc
tgtgagcccaaccccgagacgggatccttcggcacgcgcgaccgcacctgcaacgtgagc
tcgcacggcatagacggctgcgacctgctgtgttgcggtcgcggccacaacgcgcgcacc
gagcggcgcagggagaagtgccactgcgttttccactggtgttgctacgtgagctgccag
gagtgcgcgcgcatctacgacgtgcacacctgcaagtag
DBGET
integrated database retrieval system