Physeter macrocephalus (sperm whale): 102987662 Help Entry 102987662         CDS       T06011                                  Name (RefSeq) histone H2A type 1-D   KO K11251   histone H2A Organism pcad  Physeter macrocephalus (sperm whale) Pathway pcad03082   ATP-dependent chromatin remodeling pcad04217   Necroptosis pcad04613   Neutrophil extracellular trap formation pcad05034   Alcoholism pcad05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:pcad00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     102987662  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     102987662  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     102987662  09160 Human Diseases   09163 Immune disease    05322 Systemic lupus erythematosus     102987662   09165 Substance dependence    05034 Alcoholism     102987662  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pcad03036]     102987662   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pcad04147]     102987662 Chromosome and associated proteins [BR:pcad03036]  Eukaryotic type   Nucleosome assembly factors    Histones     102987662 Exosome [BR:pcad04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102987662 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  102987662 NCBI-ProteinID:  XP_007105891 UniProt:  A0A2Y9EPK5 LinkDB All DBs Position 18:complement(87174689..87175081) Genome browser AA seq 130 aa AA seqDB search MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKK TESHHKAKGK NT seq 393 nt NT seq  +upstreamnt  +downstreamnt atgtctggacgtggcaagcaaggaggcaaagctcgcgccaaggccaagactcgctcctcg cgggccgggctccagttccccgtgggccgagtgcaccgcctgcttcgcaagggcaactac tccgagcgggtcggggccggcgcaccggtgtacctggcggcggtgctggagtacctgacg gccgagatcctggagctggcgggcaacgcggctcgcgacaacaagaagacgcgcatcatc ccgcgccacctgcagctggccatccgcaacgacgaggagctcaacaagctgctgggtaaa gtcaccattgctcagggcggcgttctgcccaacatccaggcggtgctgctgcccaaaaag accgagagccaccacaaggccaagggcaagtag

DBGET integrated database retrieval system