Physeter macrocephalus (sperm whale): 102987685 Help Entry 102987685         CDS       T06011                                  Name (RefSeq) histone H2B type 1-N-like   KO K11252   histone H2B Organism pcad  Physeter macrocephalus (sperm whale) Pathway pcad04613   Neutrophil extracellular trap formation pcad05034   Alcoholism pcad05203   Viral carcinogenesis pcad05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:pcad00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     102987685  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     102987685   09163 Immune disease    05322 Systemic lupus erythematosus     102987685   09165 Substance dependence    05034 Alcoholism     102987685  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pcad03036]     102987685   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pcad04147]     102987685 Chromosome and associated proteins [BR:pcad03036]  Eukaryotic type   Nucleosome assembly factors    Histones     102987685 Exosome [BR:pcad04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102987685 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  102987685 NCBI-ProteinID:  XP_007128695 Ensembl:  ENSPCTG00005005165 UniProt:  A0A2Y9FQT7 LinkDB All DBs Position 18:87632029..87634694 Genome browser AA seq 137 aa AA seqDB search MPEPSKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM GIMNSFVNDIFERIAGEASRLAHYNKRSLLLPGELAKHAVSEGTKAVTKYTSSKRHGFEP RSWKILHGATKPVHHNY NT seq 414 nt NT seq  +upstreamnt  +downstreamnt atgcctgaaccctccaagtctgctccggccccgaagaagggctccaagaaggcggtgacc aaggctcagaagaaggacggcaagaagcgcaagcgcagccgcaaggagagctactccgtg tacgtgtacaaggtgctgaagcaggtccacccggacaccggcatctcgtccaaggccatg ggcatcatgaactcgttcgttaacgacatctttgagcgcatcgcgggcgaggcgtcgcgc ctggcgcattacaacaagcgctcgctgttgctgcccggggagctggccaagcacgccgtg tctgagggcaccaaggctgtcaccaagtacaccagctccaagagacacgggttcgagccc cggtcctggaagatcctacatggagcaaccaagcccgtgcaccacaactactga

DBGET integrated database retrieval system