Physeter macrocephalus (sperm whale): 102987742 Help Entry 102987742         CDS       T06011                                  Symbol PFN3 Name (RefSeq) profilin-3   KO K05759   profilin Organism pcad  Physeter macrocephalus (sperm whale) Pathway pcad04015   Rap1 signaling pathway pcad04810   Regulation of actin cytoskeleton pcad05014   Amyotrophic lateral sclerosis pcad05132   Salmonella infection Brite KEGG Orthology (KO) [BR:pcad00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     102987742 (PFN3)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     102987742 (PFN3)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     102987742 (PFN3)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     102987742 (PFN3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pcad04131]     102987742 (PFN3)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:pcad04812]     102987742 (PFN3)    04147 Exosome [BR:pcad04147]     102987742 (PFN3) Membrane trafficking [BR:pcad04131]  Others   Actin-binding proteins    Others     102987742 (PFN3) Cytoskeleton proteins [BR:pcad04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      102987742 (PFN3) Exosome [BR:pcad04147]  Exosomal proteins   Proteins found in most exosomes    102987742 (PFN3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Terminase-T7_RNaseH-like Motif Other DBs NCBI-GeneID:  102987742 NCBI-ProteinID:  XP_007102940 Ensembl:  ENSPCTG00005000226 UniProt:  A0A2Y9EJN5 LinkDB All DBs Position 2:complement(8113936..8114477) Genome browser AA seq 137 aa AA seqDB search MGDWKCYISAVLRDQRIDDVAIVGHSDNRCVWASRPGGLLAAISPQEVGVLTGPDRRTFL QAGLSVAGRRCCVIRDHLLAEGDGVLDARTKGLDGRAICVGHTPRALLVLMGRRGVHGGI LNKTMHELIHGLRSQGT NT seq 414 nt NT seq  +upstreamnt  +downstreamnt atgggcgactggaaatgctacatcagtgcggtgctgcgggaccagcgcatcgacgacgtg gccatcgtgggccactcggacaatcgctgcgtgtgggcatcgcggcccggtggcctgctg gcggccatctcaccgcaggaggtgggtgtactcacggggccggaccggcgcaccttcctg caggcgggcctgagcgtggcgggccgccgctgctgcgtcatccgagaccacctgctggcc gagggagacggagtgctggacgcgcgcactaaggggctggacgggcgcgccatctgcgtg ggccacacgcctcgtgctctcctcgtgcttatgggccggcggggcgtgcatgggggcatt ctcaacaagacgatgcacgagctgatccatgggctgcgctcgcagggcacctag

DBGET integrated database retrieval system