Physeter macrocephalus (sperm whale): 102989135 Help Entry 102989135         CDS       T06011                                  Symbol CSTB Name (RefSeq) cystatin-B   KO K13907   cystatin-A/B Organism pcad  Physeter macrocephalus (sperm whale) Brite KEGG Orthology (KO) [BR:pcad00001]  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:pcad01002]     102989135 (CSTB)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pcad04147]     102989135 (CSTB) Peptidases and inhibitors [BR:pcad01002]  Peptidase inhibitors   Family I25: cystatin family    102989135 (CSTB) Exosome [BR:pcad04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    102989135 (CSTB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cystatin Motif Other DBs NCBI-GeneID:  102989135 NCBI-ProteinID:  XP_028348980 UniProt:  A0A455BJ41 LinkDB All DBs Position 8:complement(13324112..13325110) Genome browser AA seq 91 aa AA seqDB search MTQRNMRVSLRSLLPQVRSQLEEKEEKFPMFKAVEFKSQVVAGRVFFIKVQVDDDKFVHI RVFESLPHERKPLVLASYQTNKSRHDELTYF NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgacacagagaaatatgcgtgtgtctctccgttctctcctcccccaggtgaggtcccag ctggaggagaaggaggagaagttcccgatgttcaaggctgtggagttcaagagccaggtg gtcgccgggagggtcttcttcatcaaggttcaagtggacgatgacaagttcgtgcacatt cgagtatttgaaagcctcccacacgagcgcaagcccttggtcttggccagctaccagacc aacaaaagcagacacgacgagctgacctacttctag

DBGET integrated database retrieval system