Physeter macrocephalus (sperm whale): 102989999
Help
Entry
102989999 CDS
T06011
Symbol
DVL1
Name
(RefSeq) segment polarity protein dishevelled homolog DVL-1 isoform X3
KO
K02353
segment polarity protein dishevelled
Organism
pcad
Physeter macrocephalus (sperm whale)
Pathway
pcad04150
mTOR signaling pathway
pcad04310
Wnt signaling pathway
pcad04330
Notch signaling pathway
pcad04390
Hippo signaling pathway
pcad04550
Signaling pathways regulating pluripotency of stem cells
pcad04916
Melanogenesis
pcad04934
Cushing syndrome
pcad05010
Alzheimer disease
pcad05022
Pathways of neurodegeneration - multiple diseases
pcad05165
Human papillomavirus infection
pcad05200
Pathways in cancer
pcad05217
Basal cell carcinoma
pcad05224
Breast cancer
pcad05225
Hepatocellular carcinoma
pcad05226
Gastric cancer
Brite
KEGG Orthology (KO) [BR:
pcad00001
]
09130 Environmental Information Processing
09132 Signal transduction
04310 Wnt signaling pathway
102989999 (DVL1)
04330 Notch signaling pathway
102989999 (DVL1)
04390 Hippo signaling pathway
102989999 (DVL1)
04150 mTOR signaling pathway
102989999 (DVL1)
09140 Cellular Processes
09144 Cellular community - eukaryotes
04550 Signaling pathways regulating pluripotency of stem cells
102989999 (DVL1)
09150 Organismal Systems
09152 Endocrine system
04916 Melanogenesis
102989999 (DVL1)
09160 Human Diseases
09161 Cancer: overview
05200 Pathways in cancer
102989999 (DVL1)
09162 Cancer: specific types
05225 Hepatocellular carcinoma
102989999 (DVL1)
05226 Gastric cancer
102989999 (DVL1)
05217 Basal cell carcinoma
102989999 (DVL1)
05224 Breast cancer
102989999 (DVL1)
09172 Infectious disease: viral
05165 Human papillomavirus infection
102989999 (DVL1)
09164 Neurodegenerative disease
05010 Alzheimer disease
102989999 (DVL1)
05022 Pathways of neurodegeneration - multiple diseases
102989999 (DVL1)
09167 Endocrine and metabolic disease
04934 Cushing syndrome
102989999 (DVL1)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Dsh_C
Dishevelled
DIX
PDZ
DEP
PDZ_6
Shufflon_N
Motif
Other DBs
NCBI-GeneID:
102989999
NCBI-ProteinID:
XP_023981201
Ensembl:
ENSPCTG00005002415
UniProt:
A0A2Y9SR89
LinkDB
All DBs
Position
3:31874678..31887339
Genome browser
AA seq
675 aa
AA seq
DB search
MAETKIIYHMDEEETPYLVKLPVAPERVTLADFKNVLSNRPVHAYKFFFKSMDQDFGVVK
EEISDDNARLPCFNGRVVSWLVLAEGTHSDAGSQGTDGHADLPPPLERTGGIGDSRPPSF
HPNVAGSRDGMDNETGTESLVSHRRERARRRNREEATRTNGHPRGDRRRDLGLPPDSAST
VLSSELESSSFIDSEEDENTSRLSSSTEQSTSSRLIRKHKRRRRKQRLRQTDRASSFSSI
TDSTMSLNIVTVTLNMERHHFLGISIVGQSNDRGDGGIYIGSIMKGGAVAADGRIEPGDM
LLQVNDVNFENMSNDDAVRVLREIVSQTGPISLTVAKCWDPTPRSYFTIPRADPVRPIDP
AAWLSHTAALTGALPRYELEEVPLTVKSDMGAVVRVMQLPDSGLEIRDRMWLKITIANAV
IGADVVDWLYTHLEGFRERREARKYASSMLKRGFLRHTVNKITFSEQCYYVFGDLCSNFA
ALNLNSGSSGASDQDTLAPLPHPAAPWPLGQGYPYQYPGPPPCFPPAYQDPGFGYGSGSA
GSQQSEGSKSSGSTRSAGGSSRRALGREKESRSAGAGGSGSESDHTVPSGVGSGGWRERP
ASQLSRGSSPRSQASAAAPGLPPLHPLTKAYSVVGGPPGGPPVRELAAVPPELTGSRQSF
QKAMGNPCEFFVDIM
NT seq
2028 nt
NT seq
+upstream
nt +downstream
nt
atggcggagaccaagatcatctatcacatggacgaggaggagacgccgtacctggtcaag
ctgcccgtggcgcccgagcgcgtcacgctggccgacttcaagaacgtgctcagcaaccgg
cccgtgcacgcctacaaattctttttcaagtccatggaccaggacttcggggttgtgaag
gaggagatctccgacgataatgctaggctgccctgcttcaacggccgcgtggtctcctgg
ctggtcctggctgagggcacacactcggatgcagggtctcagggcactgacggccatgca
gacctgcccccgcctctcgagcggacaggcggcatcggggactcccggcccccctccttc
cacccgaacgtggccggcagccgagacgggatggacaacgagaccggcacggagtccctg
gtcagccaccggcgggagcgagcccgacgccggaaccgcgaggaggccacccggaccaac
gggcacccgaggggtgaccggcggcgggacctggggctgccccccgacagcgcgtccacc
gtgctgagcagtgaacttgagtccagcagcttcatcgactcggaggaggacgaaaacacc
agccggctgagcagctccacggagcagagcacctcctcccggctcatccggaagcacaag
cgccggcggcggaagcagcgcctgcggcagacagaccgggcctcctccttcagcagcatc
acggactccaccatgtccctgaatatcgtcaccgtcacgctcaacatggagaggcaccac
ttcctgggcatcagcatcgtgggccagagcaacgaccggggcgacggcggcatctacatc
ggctccatcatgaagggcggcgccgtggccgccgacggccgcatcgagccgggtgacatg
ctgctgcaggtgaacgacgtcaactttgagaacatgagcaacgacgacgcggtgcgggtc
ctgcgggagatcgtgtcccagacagggcccatcagtctcactgtggccaagtgctgggac
ccgacgccccggagctacttcaccatcccgagggctgaccccgttcggcccatcgacccg
gccgcctggctgtcgcacacggcggcgctgaccggagccctgccccgctacgagctagag
gaggtgccgctgacggtgaagagtgacatgggcgctgtcgtccgggtcatgcagctgccg
gactcaggcctggagatccgcgaccgcatgtggctcaagatcaccatcgccaacgccgtc
atcggggcggacgtggtggactggctgtacacgcacctggagggcttccgtgagcggcgg
gaggcgcgcaagtacgccagcagcatgctgaagcgcggcttcctgcggcacacggtgaac
aagatcaccttctccgagcagtgctactacgtcttcggggacctgtgcagcaatttcgcg
gccctgaacctcaacagcggctccagcggggcctcggatcaggacacgctggccccgctg
ccccacccggccgccccctggcccctggggcagggctacccctaccagtacccggggccc
ccgccctgcttcccgcccgcgtaccaggaccctggtttcggctacggcagcggcagcgct
ggcagtcagcagagcgaaggaagcaaaagcagtgggtccacccggagcgctggcgggagc
agccgtcgggccctggggcgcgagaaggagagccggtcggctggagctgggggcagtggc
agcgagtcggaccacacagtgccaagcggggtgggcagcggcggctggcgggagcgtcct
gctagccagctcagccgtggcagcagcccgcgcagccaggcctcggccgccgccccagga
ctccccccgctgcaccccctgacaaaggcgtactcggtggtgggcgggccgcctgggggg
ccgcctgtccgggagctggccgctgtccccccagagctgacaggcagccgccagtccttc
cagaaggccatggggaacccctgtgagttctttgtcgatatcatgtga
DBGET
integrated database retrieval system