Physeter macrocephalus (sperm whale): 102990067 Help Entry 102990067         CDS       T06011                                  Name (RefSeq) monocyte chemotactic protein 1B   KO K14624   C-C motif chemokine 2 Organism pcad  Physeter macrocephalus (sperm whale) Pathway pcad04060   Cytokine-cytokine receptor interaction pcad04061   Viral protein interaction with cytokine and cytokine receptor pcad04062   Chemokine signaling pathway pcad04621   NOD-like receptor signaling pathway pcad04657   IL-17 signaling pathway pcad04668   TNF signaling pathway pcad04933   AGE-RAGE signaling pathway in diabetic complications pcad05135   Yersinia infection pcad05142   Chagas disease pcad05144   Malaria pcad05163   Human cytomegalovirus infection pcad05164   Influenza A pcad05168   Herpes simplex virus 1 infection pcad05171   Coronavirus disease - COVID-19 pcad05323   Rheumatoid arthritis pcad05417   Lipid and atherosclerosis pcad05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pcad00001]  09130 Environmental Information Processing   09132 Signal transduction    04668 TNF signaling pathway     102990067   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102990067    04061 Viral protein interaction with cytokine and cytokine receptor     102990067  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     102990067    04657 IL-17 signaling pathway     102990067    04062 Chemokine signaling pathway     102990067  09160 Human Diseases   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     102990067    05164 Influenza A     102990067    05168 Herpes simplex virus 1 infection     102990067    05163 Human cytomegalovirus infection     102990067   09171 Infectious disease: bacterial    05135 Yersinia infection     102990067   09174 Infectious disease: parasitic    05144 Malaria     102990067    05142 Chagas disease     102990067   09163 Immune disease    05323 Rheumatoid arthritis     102990067   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102990067    05418 Fluid shear stress and atherosclerosis     102990067   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     102990067  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pcad04052]     102990067    00536 Glycosaminoglycan binding proteins [BR:pcad00536]     102990067 Cytokines and neuropeptides [BR:pcad04052]  Cytokines   Chemokines    102990067 Glycosaminoglycan binding proteins [BR:pcad00536]  Heparan sulfate / Heparin   Chemokines    102990067 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  102990067 NCBI-ProteinID:  XP_023983766 Ensembl:  ENSPCTG00005012569 UniProt:  A0A2Y9SYL4 LinkDB All DBs Position 14:98100664..98102565 Genome browser AA seq 98 aa AA seqDB search MKVSAALLCLLATAAFSTQVLAQPEAINSPVTCCYTLTSKKFSMQRLMSYRRVTSSKCPK EAVIFKTILGKEICADPKQTWVQDSMRHLDNKRQTSKP NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgaaggtgtccgcagccctcctgtgcctgctcgcaacagccgccttcagcacccaggtg ctcgctcagccagaagcaattaactcgccagtcacctgctgctatacactcaccagtaag aagttctcgatgcagaggctgatgagctatagaagagtcaccagcagcaagtgtcccaaa gaagctgtgatcttcaagaccatactgggcaaggagatctgtgcagaccccaagcagacg tgggtccaggactccatgagacatctggacaacaaaaggcaaacgtcaaagccttga

DBGET integrated database retrieval system