KEGG   Physeter macrocephalus (sperm whale): 102990276
Entry
102990276         CDS       T06011                                 
Symbol
RAC1
Name
(RefSeq) ras-related C3 botulinum toxin substrate 1 isoform X2
  KO
K04392  Ras-related C3 botulinum toxin substrate 1
Organism
pcad  Physeter macrocephalus (sperm whale)
Pathway
pcad04010  MAPK signaling pathway
pcad04014  Ras signaling pathway
pcad04015  Rap1 signaling pathway
pcad04024  cAMP signaling pathway
pcad04062  Chemokine signaling pathway
pcad04071  Sphingolipid signaling pathway
pcad04145  Phagosome
pcad04148  Efferocytosis
pcad04151  PI3K-Akt signaling pathway
pcad04310  Wnt signaling pathway
pcad04360  Axon guidance
pcad04370  VEGF signaling pathway
pcad04380  Osteoclast differentiation
pcad04510  Focal adhesion
pcad04517  IgSF CAM signaling
pcad04518  Integrin signaling
pcad04520  Adherens junction
pcad04530  Tight junction
pcad04613  Neutrophil extracellular trap formation
pcad04620  Toll-like receptor signaling pathway
pcad04650  Natural killer cell mediated cytotoxicity
pcad04662  B cell receptor signaling pathway
pcad04664  Fc epsilon RI signaling pathway
pcad04666  Fc gamma R-mediated phagocytosis
pcad04670  Leukocyte transendothelial migration
pcad04722  Neurotrophin signaling pathway
pcad04810  Regulation of actin cytoskeleton
pcad04932  Non-alcoholic fatty liver disease
pcad04933  AGE-RAGE signaling pathway in diabetic complications
pcad04972  Pancreatic secretion
pcad05014  Amyotrophic lateral sclerosis
pcad05020  Prion disease
pcad05022  Pathways of neurodegeneration - multiple diseases
pcad05100  Bacterial invasion of epithelial cells
pcad05132  Salmonella infection
pcad05135  Yersinia infection
pcad05163  Human cytomegalovirus infection
pcad05167  Kaposi sarcoma-associated herpesvirus infection
pcad05169  Epstein-Barr virus infection
pcad05170  Human immunodeficiency virus 1 infection
pcad05200  Pathways in cancer
pcad05203  Viral carcinogenesis
pcad05205  Proteoglycans in cancer
pcad05208  Chemical carcinogenesis - reactive oxygen species
pcad05210  Colorectal cancer
pcad05211  Renal cell carcinoma
pcad05212  Pancreatic cancer
pcad05231  Choline metabolism in cancer
pcad05415  Diabetic cardiomyopathy
pcad05416  Viral myocarditis
pcad05417  Lipid and atherosclerosis
pcad05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102990276 (RAC1)
   04014 Ras signaling pathway
    102990276 (RAC1)
   04015 Rap1 signaling pathway
    102990276 (RAC1)
   04310 Wnt signaling pathway
    102990276 (RAC1)
   04370 VEGF signaling pathway
    102990276 (RAC1)
   04071 Sphingolipid signaling pathway
    102990276 (RAC1)
   04024 cAMP signaling pathway
    102990276 (RAC1)
   04151 PI3K-Akt signaling pathway
    102990276 (RAC1)
  09133 Signaling molecules and interaction
   04517 IgSF CAM signaling
    102990276 (RAC1)
   04518 Integrin signaling
    102990276 (RAC1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    102990276 (RAC1)
   04148 Efferocytosis
    102990276 (RAC1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102990276 (RAC1)
   04520 Adherens junction
    102990276 (RAC1)
   04530 Tight junction
    102990276 (RAC1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102990276 (RAC1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    102990276 (RAC1)
   04620 Toll-like receptor signaling pathway
    102990276 (RAC1)
   04650 Natural killer cell mediated cytotoxicity
    102990276 (RAC1)
   04662 B cell receptor signaling pathway
    102990276 (RAC1)
   04664 Fc epsilon RI signaling pathway
    102990276 (RAC1)
   04666 Fc gamma R-mediated phagocytosis
    102990276 (RAC1)
   04670 Leukocyte transendothelial migration
    102990276 (RAC1)
   04062 Chemokine signaling pathway
    102990276 (RAC1)
  09154 Digestive system
   04972 Pancreatic secretion
    102990276 (RAC1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102990276 (RAC1)
  09158 Development and regeneration
   04360 Axon guidance
    102990276 (RAC1)
   04380 Osteoclast differentiation
    102990276 (RAC1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102990276 (RAC1)
   05205 Proteoglycans in cancer
    102990276 (RAC1)
   05208 Chemical carcinogenesis - reactive oxygen species
    102990276 (RAC1)
   05203 Viral carcinogenesis
    102990276 (RAC1)
   05231 Choline metabolism in cancer
    102990276 (RAC1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102990276 (RAC1)
   05212 Pancreatic cancer
    102990276 (RAC1)
   05211 Renal cell carcinoma
    102990276 (RAC1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102990276 (RAC1)
   05163 Human cytomegalovirus infection
    102990276 (RAC1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102990276 (RAC1)
   05169 Epstein-Barr virus infection
    102990276 (RAC1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102990276 (RAC1)
   05135 Yersinia infection
    102990276 (RAC1)
   05100 Bacterial invasion of epithelial cells
    102990276 (RAC1)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    102990276 (RAC1)
   05020 Prion disease
    102990276 (RAC1)
   05022 Pathways of neurodegeneration - multiple diseases
    102990276 (RAC1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    102990276 (RAC1)
   05418 Fluid shear stress and atherosclerosis
    102990276 (RAC1)
   05415 Diabetic cardiomyopathy
    102990276 (RAC1)
   05416 Viral myocarditis
    102990276 (RAC1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    102990276 (RAC1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102990276 (RAC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pcad04131]
    102990276 (RAC1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pcad04147]
    102990276 (RAC1)
   04031 GTP-binding proteins [BR:pcad04031]
    102990276 (RAC1)
Membrane trafficking [BR:pcad04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    102990276 (RAC1)
 Endocytosis
  Lipid raft mediated endocytosis
   Arf6-dependent endocytosis
    102990276 (RAC1)
  Macropinocytosis
   Ras GTPases
    102990276 (RAC1)
 Others
  NADPH oxidases (Nox) and associated proteins
   Nox associated proteins
    102990276 (RAC1)
Exosome [BR:pcad04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102990276 (RAC1)
  Exosomal proteins of other body fluids (saliva and urine)
   102990276 (RAC1)
  Exosomal proteins of colorectal cancer cells
   102990276 (RAC1)
  Exosomal proteins of bladder cancer cells
   102990276 (RAC1)
GTP-binding proteins [BR:pcad04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    102990276 (RAC1)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU CagD
Other DBs
NCBI-GeneID: 102990276
NCBI-ProteinID: XP_023976059
Ensembl: ENSPCTG00005016300
UniProt: A0A2Y9SJX5
LinkDB
Position
14:77081726..77101608
AA seq 192 aa
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAG
QEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLR
DDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPP
PVKKRKRKCLLL
NT seq 579 nt   +upstreamnt  +downstreamnt
atgcaggccatcaagtgtgtggtggtgggagacggagctgtaggtaaaacttgcctcctg
atcagttatacgaccaatgcctttcctggagagtatatccctactgtctttgacaactat
tctgccaatgtcatggtggatggaaaaccggtgaatctgggcttgtgggatacagctgga
caagaagattatgaccgattacgtcccctatcctatccgcaaacggatgtattcttgatt
tgcttttctcttgtgagtcctgcatcatttgaaaatgttcgtgcaaagtggtaccctgaa
gtgcgacaccactgtcccaacactcctatcatcctggtggggacgaaacttgatctgagg
gatgataaagacacgattgagaaactgaaggagaagaagctgacacccatcacctaccca
cagggcttggccatggccaaggagatcggtgccgtcaaatacctggaatgctcggcgctc
acgcagcgaggtctcaagacggtgtttgatgaagctatccgggcggttctctgcccaccc
cccgtcaagaagaggaagagaaaatgcctgctgttgtga

DBGET integrated database retrieval system