Physeter macrocephalus (sperm whale): 102990617 Help Entry 102990617         CDS       T06011                                  Name (RefSeq) C-C motif chemokine 23   KO K05511   C-C motif chemokine 15/23 Organism pcad  Physeter macrocephalus (sperm whale) Pathway pcad04060   Cytokine-cytokine receptor interaction pcad04061   Viral protein interaction with cytokine and cytokine receptor pcad04062   Chemokine signaling pathway Brite KEGG Orthology (KO) [BR:pcad00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102990617    04061 Viral protein interaction with cytokine and cytokine receptor     102990617  09150 Organismal Systems   09151 Immune system    04062 Chemokine signaling pathway     102990617  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pcad04052]     102990617 Cytokines and neuropeptides [BR:pcad04052]  Cytokines   Chemokines    102990617 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 ESF1 Motif Other DBs NCBI-GeneID:  102990617 NCBI-ProteinID:  XP_007105673 UniProt:  A0A2Y9EMW1 LinkDB All DBs Position 14:complement(99300274..99304144) Genome browser AA seq 104 aa AA seqDB search MKTSIVALSCLILAAQAAVEHLMPNLNSEHSLSQGGFHRPTDCCFSYTTRKIRCVFMKDY VEMTNVCFLPAVIFITKREQHVCADPKDEQVQKCMLDLKLRSKI NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atgaagacctcaatagttgccctctcctgcctcatccttgctgcccaggctgcagttgaa cacctgatgccgaacctgaacagtgaacactcactatctcaaggaggctttcaccgtccc actgactgctgcttctcttacaccacacgaaaaatccgatgtgtattcatgaaagattat gtagaaatgaccaatgtatgcttcctgcctgctgtcatcttcatcaccaagagggagcag catgtctgtgctgaccccaaagatgagcaagttcagaaatgcatgttggacctgaagcta agatcaaagatctga

DBGET integrated database retrieval system