Physeter macrocephalus (sperm whale): 102990890 Help Entry 102990890         CDS       T06011                                  Name (RefSeq) C-C motif chemokine 14   KO K21092   C-C motif chemokine 14 Organism pcad  Physeter macrocephalus (sperm whale) Pathway pcad04060   Cytokine-cytokine receptor interaction pcad04061   Viral protein interaction with cytokine and cytokine receptor pcad04062   Chemokine signaling pathway Brite KEGG Orthology (KO) [BR:pcad00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102990890    04061 Viral protein interaction with cytokine and cytokine receptor     102990890  09150 Organismal Systems   09151 Immune system    04062 Chemokine signaling pathway     102990890  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pcad04052]     102990890 Cytokines and neuropeptides [BR:pcad04052]  Cytokines   Chemokines    102990890 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 zf-CCCH_3 Cadherin_C_2 Orexin Motif Other DBs NCBI-GeneID:  102990890 NCBI-ProteinID:  XP_028355420 Ensembl:  ENSPCTG00005015445 UniProt:  A0A455C284 LinkDB All DBs Position 14:complement(99282682..99287758) Genome browser AA seq 95 aa AA seqDB search MKVSMAAISLLLLVLITVALGSKIESYSGGPYHPTECCFSYMIRAVRRQRISSYYETSSQ CSKPGIVFITKKGHYICANPSDDWVQAYIKELEEI NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atgaaggtctccatggcagccatatccctcctcctcctcgtcctcattaccgttgccctg gggtccaagattgaatcctattcaggaggaccttaccaccccaccgagtgctgcttcagc tacatgatccgggcagtcaggcgacagcggatttcaagctattatgagaccagcagccag tgttccaagcctggaattgtcttcatcaccaaaaagggccattacatctgtgccaacccc agcgatgactgggtccaggcctatatcaaggagctggaggagatctga

DBGET integrated database retrieval system