Physeter macrocephalus (sperm whale): 102991626 Help Entry 102991626         CDS       T06011                                  Symbol CAV3 Name (RefSeq) caveolin-3   KO K12959   caveolin 3 Organism pcad  Physeter macrocephalus (sperm whale) Pathway pcad04144   Endocytosis pcad04510   Focal adhesion pcad05020   Prion disease pcad05100   Bacterial invasion of epithelial cells pcad05205   Proteoglycans in cancer pcad05410   Hypertrophic cardiomyopathy pcad05412   Arrhythmogenic right ventricular cardiomyopathy pcad05414   Dilated cardiomyopathy pcad05416   Viral myocarditis pcad05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pcad00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     102991626 (CAV3)   09144 Cellular community - eukaryotes    04510 Focal adhesion     102991626 (CAV3)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     102991626 (CAV3)   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     102991626 (CAV3)   09164 Neurodegenerative disease    05020 Prion disease     102991626 (CAV3)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     102991626 (CAV3)    05410 Hypertrophic cardiomyopathy     102991626 (CAV3)    05412 Arrhythmogenic right ventricular cardiomyopathy     102991626 (CAV3)    05414 Dilated cardiomyopathy     102991626 (CAV3)    05416 Viral myocarditis     102991626 (CAV3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pcad04131]     102991626 (CAV3) Membrane trafficking [BR:pcad04131]  Endocytosis   Lipid raft mediated endocytosis    Caveolin-mediated endocytosis     102991626 (CAV3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Caveolin Motif Other DBs NCBI-GeneID:  102991626 NCBI-ProteinID:  XP_007121837 UniProt:  A0A2Y9FFU2 LinkDB All DBs Position 18:complement(12086926..12100286) Genome browser AA seq 151 aa AA seqDB search MMAEEHTDLEAQIVKDIHFKEIDLVNRDPKNINEDIVKVDFEDVIAEPVGTYSFDGVWKV SYTTFTVSKYWCYRLLSTLLGVPLALLWGFLFACISFCHIWAVVPCIKSYLIEIQCISHI YSLCIRTFCNPLFAALGQVCGNIKVMLRKEV NT seq 456 nt NT seq  +upstreamnt  +downstreamnt atgatggccgaggagcacacagacctggaggcccagatcgtcaaggacattcacttcaag gagatcgacctggtgaaccgggaccccaagaacattaacgaggacatagtgaaggtggat ttcgaagacgtgatcgcggagcccgtgggcacgtacagctttgatggcgtgtggaaggtg agctacaccaccttcaccgtctccaagtactggtgctaccgcctgctatccacgctgctg ggggtcccgctggccctgctctggggcttcctgttcgcctgcatctccttctgccacatc tgggcggtggtgccctgcatcaagagctacctgatcgagatccagtgcatcagccacatc tactcgctgtgcatccgcaccttctgcaacccgctcttcgctgccctgggccaggtctgc ggcaacatcaaggtgatgctgcggaaagaagtgtga

DBGET integrated database retrieval system